BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M04 (518 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 24 0.93 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.7 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 23.8 bits (49), Expect = 0.93 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 422 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 315 + F F + A D C+ N T++L LK++I ++ Sbjct: 202 YVFDLFYLSKRASDLCNEANKTKILLVGLKIDIDQE 237 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 259 VVVHSEVREEAGLTTHT 209 VVV EV EE L HT Sbjct: 864 VVVKKEVDEEERLENHT 880 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,556 Number of Sequences: 336 Number of extensions: 1253 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12468463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -