BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M02 (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.9 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.1 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 5.1 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 6.7 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 6.7 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.0 bits (47), Expect = 2.9 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +2 Query: 2 FIMLVLFRFTNKQPLRDCSSQ*TMAVEQTRGSYRSGNISYYSMVRGFPA 148 F L+ FT+K R + + A+ Q +G+ S +YS+ +PA Sbjct: 394 FFSLLRDAFTSKGEYRMSTGEMKEAITQWQGNPISPLNDWYSLASSWPA 442 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 626 KIKILPCLLPTP 591 +++ LPCLLP P Sbjct: 622 ELRTLPCLLPRP 633 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 626 KIKILPCLLPTP 591 +++ LPCLLP P Sbjct: 590 ELRTLPCLLPRP 601 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/30 (23%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +1 Query: 151 VPWPSD---RWRWVGGSTAIPWFRQLINTI 231 +PW + +W G T PW ++ + Sbjct: 335 IPWDKNVEALAKWANGQTGFPWIDAIMTQL 364 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 86 FVRQPLFTENCSHVEVVC 33 +VR+ F+E+C E++C Sbjct: 426 YVREIAFSESCLPEEILC 443 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,142 Number of Sequences: 438 Number of extensions: 4304 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -