BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_L23 (587 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52720.1 68416.m05808 carbonic anhydrase family protein low s... 54 5e-08 At5g04180.1 68418.m00406 carbonic anhydrase family protein simil... 50 1e-06 At1g08065.1 68414.m00882 carbonic anhydrase family protein simil... 48 6e-06 At4g20990.1 68417.m03038 carbonic anhydrase family protein simil... 42 2e-04 At3g52720.2 68416.m05809 carbonic anhydrase family protein low s... 41 7e-04 At2g28210.1 68415.m03425 carbonic anhydrase family protein simil... 41 7e-04 At1g08080.1 68414.m00884 carbonic anhydrase family protein simil... 39 0.002 At4g21000.1 68417.m03039 carbonic anhydrase family protein simil... 39 0.003 At5g57390.1 68418.m07170 ovule development protein, putative sim... 31 0.57 At4g04970.1 68417.m00722 callose synthase, putative / 1,3-beta-g... 31 0.57 At2g30020.1 68415.m03652 protein phosphatase 2C, putative / PP2C... 29 3.0 At3g56980.1 68416.m06342 basic helix-loop-helix (bHLH) family pr... 28 4.0 At1g17160.1 68414.m02092 pfkB-type carbohydrate kinase family pr... 28 4.0 At2g28450.1 68415.m03456 zinc finger (CCCH-type) family protein ... 28 5.3 At2g03140.1 68415.m00267 CAAX amino terminal protease family pro... 27 7.0 >At3g52720.1 68416.m05808 carbonic anhydrase family protein low similarity to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 284 Score = 54.4 bits (125), Expect = 5e-08 Identities = 29/65 (44%), Positives = 38/65 (58%) Frame = -3 Query: 402 TERFYTYKGSLTTPPCAEAVTWVIFSDYLPISVFQMDNFRGLLSNLNLPLVDNFRQLQPL 223 T ++Y Y GSLTTPPC+E V+W I +S Q++ R S L+ +N R QPL Sbjct: 201 TRKYYRYIGSLTTPPCSENVSWTILGKVRSMSKEQVELLR---SPLDTSFKNNSRPCQPL 257 Query: 222 FGRRV 208 GRRV Sbjct: 258 NGRRV 262 >At5g04180.1 68418.m00406 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 277 Score = 50.0 bits (114), Expect = 1e-06 Identities = 29/70 (41%), Positives = 36/70 (51%) Frame = -3 Query: 411 GLDTERFYTYKGSLTTPPCAEAVTWVIFSDYLPISVFQMDNFRGLLSNLNLPLVDNFRQL 232 G D +FY Y+GSLTTPPC E V W I + +S Q+D L N R Sbjct: 191 GWDLTKFYEYRGSLTTPPCTEDVMWTIINKVGTVSREQID---VLTDARRGGYEKNARPA 247 Query: 231 QPLFGRRVFV 202 QPL GR V++ Sbjct: 248 QPLNGRLVYL 257 >At1g08065.1 68414.m00882 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 263 Score = 47.6 bits (108), Expect = 6e-06 Identities = 29/95 (30%), Positives = 51/95 (53%), Gaps = 3/95 (3%) Frame = -3 Query: 570 QHPDGL-CVLAFFYQVVEFDAKLLS--PIVKNLTAIENFNSTLQLPHTFSLSSILSGLDT 400 Q DG V+AFFY++ + D LL+ +K +T +++ H + G ++ Sbjct: 136 QSKDGRNAVVAFFYKLGKPDYFLLTLERYLKRITDTHESQEFVEMVHPRTF-----GFES 190 Query: 399 ERFYTYKGSLTTPPCAEAVTWVIFSDYLPISVFQM 295 + +Y + GSLTTPPC+E V W I + +++ Q+ Sbjct: 191 KHYYRFIGSLTTPPCSENVIWTISKEMRTVTLKQL 225 >At4g20990.1 68417.m03038 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 267 Score = 42.3 bits (95), Expect = 2e-04 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = -3 Query: 402 TERFYTYKGSLTTPPCAEAVTWVIFSDYLPISVFQMDNFRGLLSNLNLPLVDNFRQLQPL 223 T +FY Y GSLT PPC E V W + ++ M+ L ++ N R +Q Sbjct: 199 TRKFYRYIGSLTVPPCTEGVIWTVVK---RVNTISMEQITALRQAVDDGFETNSRPVQDS 255 Query: 222 FGRRVF 205 GR V+ Sbjct: 256 KGRSVW 261 >At3g52720.2 68416.m05809 carbonic anhydrase family protein low similarity to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 230 Score = 40.7 bits (91), Expect = 7e-04 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 402 TERFYTYKGSLTTPPCAEAVTWVI 331 T ++Y Y GSLTTPPC+E V+W I Sbjct: 201 TRKYYRYIGSLTTPPCSENVSWTI 224 >At2g28210.1 68415.m03425 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 217 Score = 40.7 bits (91), Expect = 7e-04 Identities = 24/75 (32%), Positives = 36/75 (48%) Frame = -3 Query: 555 LCVLAFFYQVVEFDAKLLSPIVKNLTAIENFNSTLQLPHTFSLSSILSGLDTERFYTYKG 376 L V+ Y++ D+ L + L+AI + N + I G + +FY Y G Sbjct: 131 LAVVTVLYKIGRPDS-FLGLLENKLSAITDQNEAEKYVDVIDPRDIKIG--SRKFYRYIG 187 Query: 375 SLTTPPCAEAVTWVI 331 SLTTPPC + V W + Sbjct: 188 SLTTPPCTQNVIWTV 202 >At1g08080.1 68414.m00884 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 275 Score = 39.1 bits (87), Expect = 0.002 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 408 LDTERFYTYKGSLTTPPCAEAVTWVI 331 + + ++Y Y GSLTTPPC + VTW + Sbjct: 205 IGSRKYYRYTGSLTTPPCTQNVTWSV 230 >At4g21000.1 68417.m03039 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 260 Score = 38.7 bits (86), Expect = 0.003 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 405 DTERFYTYKGSLTTPPCAEAVTWVI 331 +T FY Y GSLT PPC E V W + Sbjct: 199 ETNNFYRYIGSLTIPPCTEGVIWTV 223 >At5g57390.1 68418.m07170 ovule development protein, putative similar to ovule development protein AINTEGUMENTA (GI:1209099)[Arabidopsis thaliana] Length = 555 Score = 31.1 bits (67), Expect = 0.57 Identities = 20/49 (40%), Positives = 26/49 (53%) Frame = -1 Query: 245 TSGSYNRCLVAVSSSESHQRTLSSRRPNSTTPNGTGLDTRSPKMTSSTS 99 +S SY+ L SSS SHQ LS N+ N + +P +TSSTS Sbjct: 10 SSSSYDSSLSPSSSSSSHQNWLSFSLSNN---NNNFNSSSNPNLTSSTS 55 >At4g04970.1 68417.m00722 callose synthase, putative / 1,3-beta-glucan synthase, putative similar to callose synthase 1 catalytic subunit GI:13649388 from [Arabidopsis thaliana] Length = 1768 Score = 31.1 bits (67), Expect = 0.57 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -3 Query: 378 GSLTTPPCAEAVTWVIFSDYLPISV-FQMDNFRGLLSNLNLPLVDNFRQLQP 226 G L PP A+ + D+L + FQ+DN R NL L L ++ +LQP Sbjct: 51 GDLPKPPFADFTPRMDLMDWLGLLFGFQIDNVRNQRENLVLHLANSQMRLQP 102 >At2g30020.1 68415.m03652 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase 2C (GI:4587992){Arabidopsis thaliana} Length = 396 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 230 NRCLVAVSSSESHQRTLSSRRPNSTTPNGTGLDTRSPK 117 N+ + S ES TLS R+P +++P+ SPK Sbjct: 22 NKSSILSSPQESLSLTLSHRKPQTSSPSSPSTTVSSPK 59 >At3g56980.1 68416.m06342 basic helix-loop-helix (bHLH) family protein Length = 258 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = -3 Query: 441 HTFSLSSILSGLDTERF 391 H FS+S++LSGL+ +RF Sbjct: 190 HNFSISNVLSGLEEDRF 206 >At1g17160.1 68414.m02092 pfkB-type carbohydrate kinase family protein contains Pfam profile: PF00294 pfkB family carbohydrate kinase Length = 379 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 Query: 529 GCGIRCQALKSYREEPNGHRELQLHSAAAAYFLLV 425 GCG+ ++S EP GH + L S ++V Sbjct: 145 GCGVHLDYVRSVNNEPTGHAVVMLQSDGQNSIIIV 179 >At2g28450.1 68415.m03456 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 809 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 Query: 433 ESMRQLQSGVEVLDGR 480 E+ QLQSGVE+LDG+ Sbjct: 214 ENAEQLQSGVEILDGK 229 >At2g03140.1 68415.m00267 CAAX amino terminal protease family protein very low similarity to SP|Q40863 Late embryogenesis abundant protein EMB8 from Picea glauca; contains Pfam profile PF02517 CAAX amino terminal protease family protein Length = 1805 Score = 27.5 bits (58), Expect = 7.0 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 103 VDDVIFG--LLVSNPVPFGVVEFGLLELRVL*CDSDEDTATKQRL 231 VDDV+ G +L + P PF F LL +L D D + + RL Sbjct: 98 VDDVVVGEWILFTTPTPFN--RFVLLRCSLLSFDDDSEKSLSDRL 140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,039,342 Number of Sequences: 28952 Number of extensions: 281351 Number of successful extensions: 724 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -