BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_L22 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 3.6 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 4.7 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 377 NFTPSFVHEITIDSPNCERSRQILANSE 460 N + F+ I ++SP C R I NSE Sbjct: 240 NSSSFFLKAIRVESPPCLHYRAITVNSE 267 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 365 PVAENFTPSFVHEITIDSPNCERSRQILANSELGMRIV 478 PV +NF F+HE S + +R+ + L + + +V Sbjct: 434 PVLKNFPTRFIHEPWNASESVQRAAKCLIGKDYPLPMV 471 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 520,488 Number of Sequences: 2352 Number of extensions: 8493 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -