BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_L22 (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 3.3 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.8 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 234 KATSLSPQVQLSMSADVPLVVEYRIPDIGHI 142 +ATS + Q+ +S S L YR+ + G I Sbjct: 552 EATSQAMQIHISQSTKELLSPSYRVKERGEI 582 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = +2 Query: 365 PVAENFTPSFVHEITIDSPNCERSRQILANSELGMRIV 478 PV +NF ++HE N +R+ + + + + +V Sbjct: 451 PVLKNFPTRYIHEPWNAPLNVQRAAKCIIGKDYSLPMV 488 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,131 Number of Sequences: 438 Number of extensions: 2320 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -