BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_L09 (530 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 98 4e-23 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 1.5 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 1.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 3.4 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 4.5 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 4.5 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 4.5 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 4.5 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 98.3 bits (234), Expect = 4e-23 Identities = 45/99 (45%), Positives = 63/99 (63%) Frame = -1 Query: 401 APVVKSSYDITPEGHFQFNYETGNGIYAQAEGAVKNVNSEYPAIEVKGAYKYTSPDGQPI 222 A + ++ +G++ N+ET NGI Q G K V++E P + +G+ YT+PDGQ + Sbjct: 27 AVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVDNETPVVS-QGSDSYTAPDGQQV 85 Query: 221 DLAYVADENGYQPQGSHLPTPHPIPEAIARALAYIEAHP 105 + YVADENG+Q QGSH+PT PIP I RAL + AHP Sbjct: 86 SITYVADENGFQVQGSHIPTAPPIPPEIQRALEWNAAHP 124 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.4 bits (48), Expect = 1.5 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 159 SPNSRGDRPR---SCLHRGPPPQPL 94 SP+S D R SCL GPP PL Sbjct: 420 SPSSLADGARFGGSCLIHGPPLPPL 444 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.4 bits (48), Expect = 1.5 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 159 SPNSRGDRPR---SCLHRGPPPQPL 94 SP+S D R SCL GPP PL Sbjct: 420 SPSSLADGARFGGSCLIHGPPLPPL 444 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 2.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 391 SNPATTSPLKATSNSTTRPATEFT 320 + PAT S + ATSN+T T T Sbjct: 236 TGPATPSAVVATSNATAAMTTGTT 259 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = -2 Query: 385 PATTSPLKATSNSTTRPATEFTPRLKVPSRTSTQNTPP 272 PATT T+ +TT T T S PP Sbjct: 654 PATTITTITTTTTTTTTTTTTTTTPNTTQNASATTPPP 691 Score = 22.2 bits (45), Expect = 3.4 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 239 PDGQP-IDLAYVADENGYQPQGSHLPTPHPIPEAIARA 129 P+ P +DL+ + G GS T P P +I+RA Sbjct: 1369 PERVPTVDLSPSPSDRGRNDDGSDRLTSPPTPLSISRA 1406 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -2 Query: 292 STQNTPPSKLRVPTSTLPLTDNPSTSPTSLTRTVTNP 182 S N +K+ + LP+ DNP S +L NP Sbjct: 293 SRMNLTLAKMEKTSKPLPMVDNPE-STGNLVYIYNNP 328 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.5 Identities = 12/32 (37%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -1 Query: 308 GAVKNVNSEYPAIEVKGAYKYTSPDGQ--PID 219 G V + P E Y+Y PDG PID Sbjct: 264 GLPVGVTAAIPTSENPADYRYFCPDGSKVPID 295 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.5 Identities = 12/32 (37%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -1 Query: 308 GAVKNVNSEYPAIEVKGAYKYTSPDGQ--PID 219 G V + P E Y+Y PDG PID Sbjct: 264 GLPVGVTAAIPTSENPADYRYFCPDGSKVPID 295 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 307 VPSRTSTQNTPPSKLRVPTSTLP 239 +P S TP S + P TLP Sbjct: 654 LPRPISCHTTPDSFIEAPNKTLP 676 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.5 Identities = 12/32 (37%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -1 Query: 308 GAVKNVNSEYPAIEVKGAYKYTSPDGQ--PID 219 G V + P E Y+Y PDG PID Sbjct: 264 GLPVGVTAAIPTSENPADYRYFCPDGSKVPID 295 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,170 Number of Sequences: 438 Number of extensions: 3113 Number of successful extensions: 16 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -