BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_L07 (737 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 338 3e-93 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 337 6e-93 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 336 8e-93 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 336 1e-92 SB_56| Best HMM Match : Actin (HMM E-Value=0) 336 1e-92 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 336 1e-92 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 257 8e-69 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 2e-28 SB_54| Best HMM Match : Actin (HMM E-Value=0) 116 2e-26 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 86 3e-17 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 68 9e-12 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 54 1e-07 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 42 4e-04 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.006 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 32 0.56 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 5.2 SB_7681| Best HMM Match : Annexin (HMM E-Value=0) 29 5.2 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 28 6.9 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 28 9.1 SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) 28 9.1 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 338 bits (830), Expect = 3e-93 Identities = 158/171 (92%), Positives = 166/171 (97%) Frame = -2 Query: 736 EREIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQP 557 EREIVRDIKEKL YVALDFEQEMATAAAS+SLEKSYELPDGQVITIGNERFRCPEA+FQP Sbjct: 205 EREIVRDIKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQP 264 Query: 556 SFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST 377 SFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGG+TM+PGIADRMQKEI+ALAP T Sbjct: 265 SFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPT 324 Query: 376 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 224 +KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 325 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 337 bits (828), Expect = 6e-93 Identities = 158/171 (92%), Positives = 165/171 (96%) Frame = -2 Query: 736 EREIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQP 557 EREIVRDIKEKL YVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQP Sbjct: 168 EREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQP 227 Query: 556 SFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST 377 SFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGGTTMYPGIADRMQKEI+ALAP T Sbjct: 228 SFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEISALAPPT 287 Query: 376 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 224 +KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 288 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 338 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 336 bits (827), Expect = 8e-93 Identities = 158/171 (92%), Positives = 165/171 (96%) Frame = -2 Query: 736 EREIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQP 557 EREIVRDIKEKL YVALDFEQEM TAA+S+S+EKSYELPDGQVITIGNERFRCPEAL QP Sbjct: 179 EREIVRDIKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQP 238 Query: 556 SFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST 377 SFLGMES GIHET YNSIMKCDVDIRKDLYANTVMSGGTTMYPG+ADRMQKEI+ALAPST Sbjct: 239 SFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPST 298 Query: 376 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 224 +KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 299 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 349 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 336 bits (825), Expect = 1e-92 Identities = 157/171 (91%), Positives = 165/171 (96%) Frame = -2 Query: 736 EREIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQP 557 EREIVRDIKEKL YVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQP Sbjct: 206 EREIVRDIKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQP 265 Query: 556 SFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST 377 SFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEIT+LAP T Sbjct: 266 SFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPT 325 Query: 376 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 224 +KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 326 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 336 bits (825), Expect = 1e-92 Identities = 157/171 (91%), Positives = 165/171 (96%) Frame = -2 Query: 736 EREIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQP 557 EREIVRDIKEKL YVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQP Sbjct: 205 EREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQP 264 Query: 556 SFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST 377 SFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEIT+LAP T Sbjct: 265 SFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPT 324 Query: 376 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 224 +KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 325 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 336 bits (825), Expect = 1e-92 Identities = 157/171 (91%), Positives = 165/171 (96%) Frame = -2 Query: 736 EREIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQP 557 EREIVRDIKEKL YVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQP Sbjct: 206 EREIVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQP 265 Query: 556 SFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST 377 SFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEI+ALAP T Sbjct: 266 SFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPT 325 Query: 376 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 224 +KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 326 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 257 bits (629), Expect = 8e-69 Identities = 116/145 (80%), Positives = 132/145 (91%) Frame = -2 Query: 658 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 479 A S LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGME+ GIHE +YN IMKCDVDIR Sbjct: 5 ANSPILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIR 64 Query: 478 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 299 KDLY+N V+SGG+TM+PGIADRMQKEI LA +++K+K+IAPPERKYSVWIGGSILASLS Sbjct: 65 KDLYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLS 124 Query: 298 TFQQMWISKEEYDESGPGIVHRKCF 224 TFQQMWI+KEEY E GP IVHRKCF Sbjct: 125 TFQQMWIAKEEYHEYGPPIVHRKCF 149 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 122 bits (295), Expect = 2e-28 Identities = 72/189 (38%), Positives = 105/189 (55%), Gaps = 29/189 (15%) Frame = -2 Query: 730 EIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSF 551 E VR +KEKL YV + EQE A +T L + Y LPDG+V+ + ERF PEALFQP Sbjct: 211 ETVRMMKEKLCYVGYNIEQEQKLALETTVLVEQYTLPDGRVVKLSGERFEAPEALFQPHL 270 Query: 550 LGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITAL------ 389 + +E G+ E ++N+I D+D R + Y + V+SGG+TMYPG+ R+++EI L Sbjct: 271 INVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVL 330 Query: 388 ---------------APSTI-----KIKI-IAPP-ERKYSVWIGGSILAS-LSTFQQMWI 278 P T K KI I P RK+ V++GG++LA + W+ Sbjct: 331 KGDTSKLSSGMGMEQIPLTADYLLQKFKIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWM 390 Query: 277 SKEEYDESG 251 +++EY+E G Sbjct: 391 TRKEYEEKG 399 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 116 bits (280), Expect = 2e-26 Identities = 52/97 (53%), Positives = 70/97 (72%) Frame = -2 Query: 736 EREIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQP 557 E++I+RD+KE L Y A+D+E+E+ A S E Y LPDGQ I IG+ERFR E LFQP Sbjct: 2250 EQQIIRDLKETLCYCAMDYERELKEAETSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQP 2309 Query: 556 SFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSG 446 S LG + GIHE+++ SI KCD+D+R +L+ N V+SG Sbjct: 2310 SLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 85.8 bits (203), Expect = 3e-17 Identities = 48/145 (33%), Positives = 74/145 (51%), Gaps = 17/145 (11%) Frame = -2 Query: 607 ITIGNERFRCPEALFQPSFLGME-SCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMY 431 + + ERF PE F P F + + + E V N I C +D+R+ LY N V+SGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Query: 430 PGIADRMQKEIT----------------ALAPSTIKIKIIAPPERKYSVWIGGSILASLS 299 R+Q++I + P I+ ++I+ ++Y+VW GGS+LAS Sbjct: 256 RDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTP 315 Query: 298 TFQQMWISKEEYDESGPGIVHRKCF 224 F + +K +YDE GP I F Sbjct: 316 EFYSVCHTKADYDEHGPSICRHNPF 340 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 67.7 bits (158), Expect = 9e-12 Identities = 29/85 (34%), Positives = 55/85 (64%), Gaps = 3/85 (3%) Frame = -2 Query: 547 GMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKI 368 G + G+ + V S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P ++++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 367 KII---APPERKYSVWIGGSILASL 302 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 54.0 bits (124), Expect = 1e-07 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 9/104 (8%) Frame = -2 Query: 541 ESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST----- 377 E + + +S++ C +D RK L N V+ GGT M PG R+ +EI L S Sbjct: 54 EEKSLATALLDSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDK 113 Query: 376 --IK-IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKEEYDE 257 IK +K+ PP + W+GG+I SL ++E Y + Sbjct: 114 LFIKTVKMHQPPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 54.0 bits (124), Expect = 1e-07 Identities = 27/61 (44%), Positives = 37/61 (60%) Frame = -2 Query: 730 EIVRDIKEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSF 551 +IV DIKEK+ Y++ D +E+ + L K Y LPDGQ+I+IG E E LF+P Sbjct: 838 QIVNDIKEKICYLSKDHLKEVHNYKTNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDL 897 Query: 550 L 548 L Sbjct: 898 L 898 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 736 EREIVRDIKEKLXYVALDFEQEM 668 EREIVRDIKEKL YVALDF QE+ Sbjct: 84 EREIVRDIKEKLCYVALDFYQEI 106 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = -2 Query: 529 IHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPG 425 I E + +I K D+D+R+ LY+N V+SGG+T++ G Sbjct: 257 IIEVLAFAIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 32.7 bits (71), Expect = 0.32 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 577 PEALFQPSFLGMESCGIHETV 515 PE +FQPS LG+E GI ET+ Sbjct: 3 PEIIFQPSMLGLEQAGITETM 23 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 31.9 bits (69), Expect = 0.56 Identities = 21/75 (28%), Positives = 36/75 (48%) Frame = -1 Query: 533 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRS 354 R P+DR + HH RR H +HR H R++R+ +G+ L+ +D Sbjct: 830 RPPQDRHRRHHHRRRHHN----NKHRKHSREHSRRRHQRKHHKGNDAQETLEEIFED--D 883 Query: 353 PREEVLRMDRWIHPG 309 R+E +D +++ G Sbjct: 884 ARDEKENVDEFVNGG 898 Score = 27.9 bits (59), Expect = 9.1 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = -1 Query: 557 FLPGYGIVRHP-RDRVQLHHEV-RRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRA 384 F+ G G++ H + Q+ E R + G +HRH R +HH ++ R+ + + A Sbjct: 894 FVNGGGMMEHELQSDSQISQETGARENDPGKKHKHRHRRHHHHRRQHNRKIKKHRRKHSA 953 Query: 383 LDHQ 372 H+ Sbjct: 954 RKHE 957 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 315 MDPPIHTEYFLSGGAMILILMVEGARAVISFCILSAIPGYMV-VPPD 452 +DPP+ +Y L+GG ++ ++ FCI G++V PP+ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCIFQ---GFVVPTPPE 801 >SB_7681| Best HMM Match : Annexin (HMM E-Value=0) Length = 426 Score = 28.7 bits (61), Expect = 5.2 Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 2/75 (2%) Frame = -1 Query: 530 HPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDH--R 357 HP ++ HHE R P H H P ++ E P DH++++ Sbjct: 316 HPPEQ---HHEEEERGVHPPGEHHEEEERGAHPPGQDLEEEERGAHPPGQDHEEEERGAH 372 Query: 356 SPREEVLRMDRWIHP 312 P + +R +HP Sbjct: 373 PPEQHHEEEERGVHP 387 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 6.9 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 463 NTVMSGGTTMYPGIADRMQKEITALAP 383 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 6.9 Identities = 20/77 (25%), Positives = 29/77 (37%), Gaps = 4/77 (5%) Frame = -1 Query: 533 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYR--RQDAEGDHRPR--ALDHQDQ 366 RH R R + R RH RH H R++ R + R R H+ Sbjct: 23 RHERSRHETRQHERSRHKTSRHESSRHKTSRHERSRHKTSRHETSRHERSRHETRQHERS 82 Query: 365 DHRSPREEVLRMDRWIH 315 H++ R E R ++ H Sbjct: 83 RHKTSRHETSRHEKSRH 99 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 28.3 bits (60), Expect = 6.9 Identities = 18/69 (26%), Positives = 27/69 (39%) Frame = -1 Query: 578 SRGSLPAFLPGYGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGD 399 +R ++P LPG H R R HH ++H ++ HH Q + Sbjct: 930 ARPNMPGTLPGNYPESHKRHRHSHHHH------------YQHYQYNHHHDHQSHQHHDSH 977 Query: 398 HRPRALDHQ 372 H LDH+ Sbjct: 978 HHREVLDHK 986 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/89 (33%), Positives = 36/89 (40%), Gaps = 3/89 (3%) Frame = -1 Query: 536 VRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVP-RYRRQDAEGDHRPRALDHQDQD- 363 V HPR V +H HP V HR +H + RQDA DH + + H QD Sbjct: 606 VVHPRRDV-VHPRQDVVHPRQDVDHHRQDVDHHRQDVDHHRQDA--DHHRQDVVHPRQDV 662 Query: 362 -HRSPREEVLRMDRWIHPGFPVHLPADVD 279 HR + R D H VH D D Sbjct: 663 VHRRQDADHRRQDADHHRQDVVHPRQDAD 691 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 28.3 bits (60), Expect = 6.9 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = -1 Query: 527 PRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHR 357 PRDR + E RRR P R+ R + Y PR RR+ R R D R Sbjct: 854 PRDRRRRSPEHRRRREASPPRRDR--KRYDSPPRRRRRSPSPPPRRRRRDSYSPSRR 908 >SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 466 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 347 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNRLTELGIVKEKIIAPPE 84 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 9.1 Identities = 18/73 (24%), Positives = 27/73 (36%) Frame = -1 Query: 533 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRS 354 RH R R + R RH RH H R++ E R+ H+ + H Sbjct: 63 RHERSRHETRQHERSRHKTSRHESSRHKTSRHGRSRHKTSRHETSRHERS-RHETRQHER 121 Query: 353 PREEVLRMDRWIH 315 R + R ++ H Sbjct: 122 SRHKTSRHEKSRH 134 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 712 KEKLXYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPE 572 +EK+ L+ E E A + LEK +L + +G+ER RC + Sbjct: 2983 REKIVTSDLESELETERALQANELEKQNKLLEKLSADLGHERSRCED 3029 >SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/67 (23%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = -1 Query: 506 HHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDH--RSPREEVLR 333 HHE R P + H H P ++ E P H++++ P E Sbjct: 154 HHEEEERGVHPPGQHHEEEERGVHPPGQHHEEEERGVHPPGQHHEEEERGVHPPEEHHEE 213 Query: 332 MDRWIHP 312 +R +HP Sbjct: 214 EERGVHP 220 >SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) Length = 647 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/65 (23%), Positives = 29/65 (44%) Frame = -1 Query: 536 VRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHR 357 ++HP ++ H + ++ P + HHVP + +A G+ R Q+ D+ Sbjct: 550 IQHPVEKAIQHAQEKKYQP----ELEKKTIKSHHVPGQDKTEARGEERIAVWSTQNGDYY 605 Query: 356 SPREE 342 R+E Sbjct: 606 DQRDE 610 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,373,268 Number of Sequences: 59808 Number of extensions: 436011 Number of successful extensions: 1409 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1387 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -