BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_L06 (596 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 75 2e-15 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 4.3 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 23 5.7 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 5.7 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.5 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 7.5 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 74.5 bits (175), Expect = 2e-15 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = -3 Query: 591 ARGLDVDGIKYVINFDYPNSSEDYIHRIGRTGRSKSKGTSYAFFTPSNSR-QAKDLVSVL 415 ARGLD+ + +V+N+D P S +DY+HRIGRTGR +KG + +F+ P R A DLV +L Sbjct: 484 ARGLDIKNVNHVVNYDLPKSIDDYVHRIGRTGRVGNKGRATSFYDPEADRAMASDLVKIL 543 Query: 414 QEANQMI 394 +A Q + Sbjct: 544 TQAGQSV 550 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.8 bits (49), Expect = 4.3 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +3 Query: 168 LSILRGFTLL---EMPTKILFNSRQIVCNHCPPFGY 266 +++LR F + P KI+F+ + + + PP Y Sbjct: 466 ITLLRNFRFTPSSQTPAKIVFDPKSFILSPVPPVNY 501 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 23.4 bits (48), Expect = 5.7 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = -2 Query: 517 PSYWENWTFKIKRNI 473 PS W W+ +KR + Sbjct: 219 PSLWNKWSLSVKRRL 233 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 5.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 303 HHLVHLRRICSCSTRRHHHRN 365 HHL H + +T HHH++ Sbjct: 707 HHLSHHHGGAAAATGHHHHQH 727 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 297 SRHHLVHLRRICSCSTRRHHHRNGRPS 377 SRHH+ + + ++ HHHR P+ Sbjct: 40 SRHHVHMMPEMHGAYSQVHHHRAQDPT 66 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 297 SRHHLVHLRRICSCSTRRHHHRNGRPS 377 SRHH+ + + ++ HHHR P+ Sbjct: 40 SRHHVHMMPEMHGAYSQVHHHRAQDPT 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 580,958 Number of Sequences: 2352 Number of extensions: 11105 Number of successful extensions: 234 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 234 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -