BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_L05 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) 46 2e-05 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_41172| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-21) 31 1.2 SB_50940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_11654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) 28 6.5 SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 28 8.6 SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) Length = 81 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -3 Query: 321 SESLIKQIPRLLGPGLNKAGKXP 253 S+SLIKQIPR+LGPGLNKAGK P Sbjct: 28 SDSLIKQIPRILGPGLNKAGKFP 50 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 32.3 bits (70), Expect = 0.40 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = -2 Query: 160 SVAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMKST 29 ++ VGH E+ N+ +++ L ++ + W N++SL++K++ Sbjct: 322 AMKVGHTGQEKKEVISNIVEAVSGLAKIIPRGWNNIQSLNIKTS 365 >SB_41172| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-21) Length = 342 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 5/74 (6%) Frame = +1 Query: 385 FQSLSIHTWHIQGFSLVTMLLVSKNA----NLHFRPRYVF*LYSAGETLVLLWVIVLQTN 552 + S + TW + S +T+ +S LH R + +F + A L+++W+I L N Sbjct: 100 YMSFELSTWLLLMSSFLTLTAISCERFAALTLHLRYQQMFTMKRAAMALIMIWLISLSLN 159 Query: 553 -LKLYSLQKVTFLV 591 ++L L+ + + + Sbjct: 160 VIRLLLLESLFWCI 173 >SB_50940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 76 AVTQGS*WKDAHSEQAHQESCPH 144 AV+ WK H+ Q QESCPH Sbjct: 103 AVSNPCFWKWIHAHQTAQESCPH 125 >SB_11654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +1 Query: 409 WHIQGFSLVTMLLVSKNANLHFRPRYVF*LYSAGETLVLLWVIVLQTNLKLYSLQKVTFL 588 W I LV L+ + N + R ++VF + E L+ +W + +T L +Q F+ Sbjct: 296 WFIWTAVLVDALIQANNGSWRRRAQFVFTILFDIEALIKIWCVGFRTYLNSSRMQFFEFI 355 Query: 589 V 591 + Sbjct: 356 L 356 >SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 163 LSVAVGHVDMTPDELAQNVHLSINFLVSLLKKH 65 +S AV + TPD ++ V +N L SL KKH Sbjct: 654 VSSAVSEMSDTPDNVSNQVEKVVNELKSLKKKH 686 >SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) Length = 1286 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 99 PSTSLCHCSRNTGRMSD 49 PS CHC N GRM D Sbjct: 526 PSDPTCHCPSNNGRMKD 542 >SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 1243 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = -3 Query: 558 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHC 436 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHC 376 >SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1867 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/64 (25%), Positives = 30/64 (46%) Frame = +1 Query: 409 WHIQGFSLVTMLLVSKNANLHFRPRYVF*LYSAGETLVLLWVIVLQTNLKLYSLQKVTFL 588 W I LV L+ + N + + ++VF + E L+ +W + +T L +Q F+ Sbjct: 395 WFIWFAVLVDALIQANNGSWRRQAQFVFTILFDIEALIKIWCVGFRTYLNSSRMQFFEFI 454 Query: 589 VLRG 600 + G Sbjct: 455 LAVG 458 >SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = -3 Query: 558 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHC 436 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHC 376 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,890,090 Number of Sequences: 59808 Number of extensions: 450469 Number of successful extensions: 1043 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1038 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -