BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K22 (877 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 23 2.4 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 2.4 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 7.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 7.3 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 9.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 9.6 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.6 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -1 Query: 208 NYYILIEFTLQ--AGFLYC*VGWSRNXNTLHXCKSAFGXVXA*E 83 N + ++FT+Q FL C + NTL+ C+SA + + E Sbjct: 67 NGHNCLDFTVQNILTFLSCRFHQGASYNTLNTCRSALALLLSPE 110 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 477 TKQCKSKFKHHYLHIMVGLDHFCARRP 557 TKQ F +H+LH +G +R P Sbjct: 95 TKQNTKSFIYHFLHSWLGTGLLTSRGP 121 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 655 LCLFYNKRCYKRTIQTHTTFIGIRNGEFF*YG 750 LC FY K C + + T +R GE + +G Sbjct: 541 LCNFYRKFCARYSAATQDLNKLLRKGEKWRWG 572 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 326 YALAAFIVMSILGICLKLMYYLGKCF 249 YA F V +L +C+ YY+ F Sbjct: 243 YAFILFTVHLLLLVCIYYFYYMHLLF 268 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 394 SKTGLSLVSPIVNTWL 441 ++TG ++ IVNTW+ Sbjct: 296 TRTGANIKKLIVNTWI 311 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 9.6 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 110 TLAXMQCVXIS*PTNSTIQKTSLQGELYKYVVVSNRE 220 TL V I STIQ+ S GEL + ++ E Sbjct: 916 TLYTANVVCICHVCYSTIQEVSKSGELIHKIATNDHE 952 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 477 TKQCKSKFKHHYLHIMVG 530 TKQ F +H+LH +G Sbjct: 95 TKQNTKSFIYHFLHSWLG 112 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,467 Number of Sequences: 336 Number of extensions: 4091 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -