BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K22 (877 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0430 + 3774769-3774966,3776951-3777142 29 6.5 08_01_0307 - 2604863-2604931,2605177-2606136 28 8.5 >08_01_0430 + 3774769-3774966,3776951-3777142 Length = 129 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 174 LVFCIVELVGQEXKTHCMXARVHLEXXAHE 85 +VFC+V L+G HC +H E A E Sbjct: 97 IVFCLVILLGIPVMGHCTLKEIHEEMKARE 126 >08_01_0307 - 2604863-2604931,2605177-2606136 Length = 342 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +3 Query: 282 ANSKDAHYNKGRQRISC--LTHFFSYSCLCSATYFKQFLKQNRP 407 A++ D+ Y KG +IS L FS+S +C T+ +++LK +P Sbjct: 114 AHAVDSVYQKGVHQISILDLNVAFSFSIIC--THHEEYLKSTQP 155 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,105,686 Number of Sequences: 37544 Number of extensions: 369014 Number of successful extensions: 711 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -