BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K22 (877 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) 30 2.8 SB_2369| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_35066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 >SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1432 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 161 IQKTSLQGELYKYVVVSNRETY*SKLICVQNTFLNSTLILSKFQGCSLQ*RPP 319 ++ +SLQ + Y++++ N L NTFLN + L K + RPP Sbjct: 334 VEMSSLQKQYYRWILTKNYRALNKGLKGNSNTFLNIVMELKKCSNHASLTRPP 386 >SB_2369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -2 Query: 336 LGNLCAGGLYCNEHPWNLLKINVLFRKVFCTQ 241 +G + +C E P++LL VL+RK FCT+ Sbjct: 307 MGKVLYRNKFCTE-PYSLLMGKVLYRKKFCTE 337 >SB_35066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 299 SILGICLKLMYYLGKC 252 SILGICL +YY KC Sbjct: 72 SILGICLDYLYYYDKC 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,301,655 Number of Sequences: 59808 Number of extensions: 469364 Number of successful extensions: 1011 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1011 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -