BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K14 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 22 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.4 Identities = 19/71 (26%), Positives = 29/71 (40%), Gaps = 7/71 (9%) Frame = -2 Query: 264 LHPPSFQCSSDGEVGPQVVPEARLQLPTHTA----QVEEASPQATPPPTVDPD---RTKN 106 LHP F C G + VP L L ++ V + + T P DP+ + + Sbjct: 994 LHPQEFNCLKYGVIYYVTVPSMYLLLVIYSVFNMNNVSWGTREVTVVPKPDPNAVQKIEE 1053 Query: 105 WKPETXMEIET 73 KPE ++ T Sbjct: 1054 KKPEKKDKVLT 1064 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.4 Identities = 19/71 (26%), Positives = 29/71 (40%), Gaps = 7/71 (9%) Frame = -2 Query: 264 LHPPSFQCSSDGEVGPQVVPEARLQLPTHTA----QVEEASPQATPPPTVDPD---RTKN 106 LHP F C G + VP L L ++ V + + T P DP+ + + Sbjct: 994 LHPQEFNCLKYGVIYYVTVPSMYLLLVIYSVFNMNNVSWGTREVTVVPKPDPNAVQKIEE 1053 Query: 105 WKPETXMEIET 73 KPE ++ T Sbjct: 1054 KKPEKKDKVLT 1064 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 575 CRYQLRTATRKRSLLPSATREPDLQPHSSDRAG 477 C+Y R T+ +LL D +P+S D G Sbjct: 82 CKYCNRQFTKSYNLLIHERTHTDERPYSCDICG 114 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 172 CCMRWQLQSGLRDHLR 219 C M+W L S + HLR Sbjct: 524 CGMKWPLLSTINRHLR 539 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -2 Query: 267 CLHPPSFQCSSDGEVGPQVVPEARLQL 187 CLHP F C G + +P L L Sbjct: 1020 CLHPQEFWCIVPGIIYLLSIPSMYLLL 1046 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -2 Query: 267 CLHPPSFQCSSDGEVGPQVVPEARLQL 187 CLHP F C G + +P L L Sbjct: 1020 CLHPQEFWCIVPGIIYLLSIPSMYLLL 1046 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -2 Query: 267 CLHPPSFQCSSDGEVGPQVVPEARLQL 187 CLHP F C G + +P L L Sbjct: 1020 CLHPQEFWCIVPGIIYLLSIPSMYLLL 1046 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -2 Query: 267 CLHPPSFQCSSDGEVGPQVVPEARLQL 187 CLHP F C G + +P L L Sbjct: 1020 CLHPQEFWCIVPGIIYLLSIPSMYLLL 1046 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,116 Number of Sequences: 336 Number of extensions: 3113 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -