BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K11 (384 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT007293-1|AAP35957.1| 51|Homo sapiens ATP synthase, H+ transp... 52 8e-07 BC105811-1|AAI05812.1| 51|Homo sapiens ATP5E protein protein. 52 8e-07 BC003671-1|AAH03671.1| 51|Homo sapiens ATP synthase, H+ transp... 52 8e-07 BC001690-1|AAH01690.1| 51|Homo sapiens ATP synthase, H+ transp... 52 8e-07 AL591024-1|CAH70632.1| 51|Homo sapiens protein ( Human DNA seq... 52 8e-07 AL109840-12|CAC09372.1| 51|Homo sapiens ATP synthase, H+ trans... 52 8e-07 AF052955-1|AAF72736.1| 51|Homo sapiens F1-ATPase epsilon-subun... 52 8e-07 L24158-1|AAA16099.1| 1000|Homo sapiens integrin alpha 9 protein ... 29 6.8 D25303-1|BAA04984.1| 1035|Homo sapiens integrin alpha subunit pr... 29 6.8 >BT007293-1|AAP35957.1| 51|Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit protein. Length = 51 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 258 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRV 136 WRQAGL+YI YS I AK +R +LK EF+A A K S+V++ Sbjct: 5 WRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKI 45 >BC105811-1|AAI05812.1| 51|Homo sapiens ATP5E protein protein. Length = 51 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 258 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRV 136 WRQAGL+YI YS I AK +R +LK EF+A A K S+V++ Sbjct: 5 WRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKI 45 >BC003671-1|AAH03671.1| 51|Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit protein. Length = 51 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 258 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRV 136 WRQAGL+YI YS I AK +R +LK EF+A A K S+V++ Sbjct: 5 WRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKI 45 >BC001690-1|AAH01690.1| 51|Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit protein. Length = 51 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 258 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRV 136 WRQAGL+YI YS I AK +R +LK EF+A A K S+V++ Sbjct: 5 WRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKI 45 >AL591024-1|CAH70632.1| 51|Homo sapiens protein ( Human DNA sequence from clone RP11-153M24 on chromosome 13 Contains a novel gene similar to ATP synthase (H+ transporting, mitochondrialnase, an). Length = 51 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 258 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRV 136 WRQAGL+YI YS I AKV+R +LK EF+A A K + V++ Sbjct: 5 WRQAGLSYIRYSQICAKVVRDALKTEFKANAKKTSGNSVKI 45 >AL109840-12|CAC09372.1| 51|Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit protein. Length = 51 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 258 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRV 136 WRQAGL+YI YS I AK +R +LK EF+A A K S+V++ Sbjct: 5 WRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKI 45 >AF052955-1|AAF72736.1| 51|Homo sapiens F1-ATPase epsilon-subunit protein. Length = 51 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 258 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRV 136 WRQAGL+YI YS I AK +R +LK EF+A A K S+V++ Sbjct: 5 WRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKI 45 >L24158-1|AAA16099.1| 1000|Homo sapiens integrin alpha 9 protein protein. Length = 1000 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 189 LVTCEAPWLRCLSSLCKLNQLASKRSFC*CSYLLLFSKI 305 ++ CE P + CL++ C + LA + S Y+LL ++I Sbjct: 853 VLDCEKPGISCLTAHCNFSALAKEESRTIDIYMLLNTEI 891 >D25303-1|BAA04984.1| 1035|Homo sapiens integrin alpha subunit protein. Length = 1035 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 189 LVTCEAPWLRCLSSLCKLNQLASKRSFC*CSYLLLFSKI 305 ++ CE P + CL++ C + LA + S Y+LL ++I Sbjct: 888 VLDCEKPGISCLTAHCNFSALAKEESRTIDIYMLLNTEI 926 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,942,848 Number of Sequences: 237096 Number of extensions: 916405 Number of successful extensions: 1815 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1815 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2583773550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -