BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K06 (419 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 23 1.6 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 3.7 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 22.6 bits (46), Expect = 1.6 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -1 Query: 245 VFKRNTPSLSVI*YAKLSDTLNMRRGLWSYLRCQKTSVXLKXLKRRL 105 +F P L+ I + TLN RR L L+C + RRL Sbjct: 19 IFTCVKPQLTRISDEAIESTLNDRRYLLRQLKCATGEAPCDPVGRRL 65 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 3.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 262 PNSDGFVCDTLAASGYFSCFVAFSQAYCDF 351 P +G VC T+ A +C F C+F Sbjct: 346 PCQNGGVCTTIHAGHKCTCPEGFYGKNCEF 375 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,597 Number of Sequences: 336 Number of extensions: 1552 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9279512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -