BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K06 (419 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-6|CAD29635.1| 152|Anopheles gambiae putative protein p... 23 3.4 AJ439398-5|CAD28128.1| 152|Anopheles gambiae putative protein p... 23 3.4 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 6.0 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 22 7.9 >AJ441131-6|CAD29635.1| 152|Anopheles gambiae putative protein protein. Length = 152 Score = 23.4 bits (48), Expect = 3.4 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -3 Query: 288 ITDKAI-RIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDK 136 IT+K + R P R G + + R +++++ HA Y +L + DK Sbjct: 3 ITEKDLYRDTPVRYLGYANEIGEAFRPVIKKIFVHASYAVAISYVLADTADK 54 >AJ439398-5|CAD28128.1| 152|Anopheles gambiae putative protein protein. Length = 152 Score = 23.4 bits (48), Expect = 3.4 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -3 Query: 288 ITDKAI-RIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDK 136 IT+K + R P R G + + R +++++ HA Y +L + DK Sbjct: 3 ITEKDLYRDTPVRYLGYANEIGEAFRPVIKKIFVHASYAVAISYVLADTADK 54 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 266 ILMALSVIPLRPADILVVLWPFRR 337 +L+ L +PL +IL WP R Sbjct: 88 LLLCLVTMPLTLVEILTKYWPMGR 111 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 149 CQKTSVXLKXLKRRLGTHIRAK 84 C SV L LKR + TH K Sbjct: 217 CDYASVELSKLKRHIRTHTGEK 238 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 381,188 Number of Sequences: 2352 Number of extensions: 7801 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -