BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K04 (725 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB291062-1|BAF73936.1| 157|Caenorhabditis elegans dihydrofolate... 30 1.9 AF003151-1|AAK18921.2| 1184|Caenorhabditis elegans Hypothetical ... 28 5.9 >AB291062-1|BAF73936.1| 157|Caenorhabditis elegans dihydrofolate reductase protein. Length = 157 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 55 FGSXLNQLVVMSSIVDTVFTDGGAYVGNSIIFVKNLSYLSIV 180 F S N L +S + D V+ GG + NS+I ++ +LS V Sbjct: 77 FPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTV 118 >AF003151-1|AAK18921.2| 1184|Caenorhabditis elegans Hypothetical protein D1007.15 protein. Length = 1184 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 111 HRWRRLCRQQYYFC*KSFLFI 173 HR ++C +YFC ++FLFI Sbjct: 43 HRPNKVCTFSHYFCTRTFLFI 63 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,629,381 Number of Sequences: 27780 Number of extensions: 243704 Number of successful extensions: 403 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -