BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_K03 (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 3.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.4 EF034031-1|ABK32002.1| 70|Anopheles gambiae serpin 4A protein. 23 9.4 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.4 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 9.4 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 3.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 355 IQIVPPKTQLLSIKTTNNRYSL*FRIGSM 269 +QI P KT+ + I +T N + R+G + Sbjct: 761 LQIAPEKTECVLISSTKNPTQVTIRVGDV 789 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 80 FFLTFLLCINVKLLXSLHYREPP 12 + + L+ +N +L + HYR+PP Sbjct: 489 WLIIILVFLNTGVLATEHYRQPP 511 >EF034031-1|ABK32002.1| 70|Anopheles gambiae serpin 4A protein. Length = 70 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 234 FVYKNKIVKHLTIE 275 FVY N+IV H+T++ Sbjct: 4 FVYVNEIVTHVTLD 17 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 9.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 524 WLKHSFHQIEFYARFRFIFYDRKVTQQIRMTHVAAARVA 640 W K + H E++A FY+ +TQ +HV + VA Sbjct: 1741 WTKLTSHLKEYFA-----FYENFITQVHGTSHVMSGMVA 1774 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +1 Query: 190 EIKTDFFEIKQYETSLYTKIRLSNI*PLNQF*TINYT 300 E+ + FE+K+Y S + + ++ PL + +N T Sbjct: 208 ELVSKTFEVKEYVLSTFDVQVMPSVIPLEEHQAVNLT 244 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,894 Number of Sequences: 2352 Number of extensions: 13389 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -