BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_I22 (472 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57861| Best HMM Match : Ribosomal_S30 (HMM E-Value=2e-32) 99 2e-21 SB_46227| Best HMM Match : DUF1303 (HMM E-Value=6.4) 27 5.9 SB_23891| Best HMM Match : P60 (HMM E-Value=2.2) 27 5.9 SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_57861| Best HMM Match : Ribosomal_S30 (HMM E-Value=2e-32) Length = 61 Score = 99.1 bits (236), Expect = 2e-21 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = -3 Query: 203 KVHGSLARAGKVKGQTPKVEXXXXXXXKTGRAKRRIQYNRRFVNVVQTFGRRRGPNAN 30 KVHGSLARAGKVK QTPKV+ KTGRAKRR+QYNRRFVNVVQTFGRRRGPN+N Sbjct: 2 KVHGSLARAGKVKSQTPKVDAQEKKKKKTGRAKRRMQYNRRFVNVVQTFGRRRGPNSN 59 >SB_46227| Best HMM Match : DUF1303 (HMM E-Value=6.4) Length = 610 Score = 27.5 bits (58), Expect = 5.9 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 173 YLHEPKIRALYHQAMAL*GLVQMMRAQRQDMNHLKELHIMI 295 YLH PK H+ M + M+ + +D +HLKE +MI Sbjct: 336 YLHHPK----EHEVMI--PYIAMVSEENEDFHHLKEHEVMI 370 >SB_23891| Best HMM Match : P60 (HMM E-Value=2.2) Length = 1167 Score = 27.5 bits (58), Expect = 5.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 159 NPQSGKTTKKEEEDWP 112 NP GKT +E++DWP Sbjct: 384 NPPQGKTPIEEDDDWP 399 >SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 27.1 bits (57), Expect = 7.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 274 KGAPHNDRVRSSSPTAARVRMRS 342 +G+PH R R+SSP AR R S Sbjct: 729 RGSPHQPRGRASSPGGARGRAAS 751 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,712,563 Number of Sequences: 59808 Number of extensions: 214066 Number of successful extensions: 542 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -