BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_I15 (335 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-2855|AAF57579.1| 655|Drosophila melanogaster CG7461-PA... 28 2.6 AE014297-1753|AAF54983.1| 776|Drosophila melanogaster CG14366-P... 27 8.0 >AE013599-2855|AAF57579.1| 655|Drosophila melanogaster CG7461-PA protein. Length = 655 Score = 28.3 bits (60), Expect = 2.6 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 80 QCXGPSRCRQNSQEVSRRNMQSTQQVKYTQRQLGRCRQLGTHTPK 214 Q GP N+ E R+ + Q +Y CRQ+ TH+PK Sbjct: 14 QTLGPKGDLPNNFETMWRH--TIQSTRYLAGNASLCRQIATHSPK 56 >AE014297-1753|AAF54983.1| 776|Drosophila melanogaster CG14366-PA protein. Length = 776 Score = 26.6 bits (56), Expect = 8.0 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +2 Query: 92 PSRCRQNSQEVSRRNMQSTQQVKYTQRQLGRCRQLGTHTPK 214 P Q Q SRR M TQQ+ Y Q+Q R +Q P+ Sbjct: 551 PEHNEQQQQHPSRRLMSPTQQL-YQQQQHQRSQQQQQQQPQ 590 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,822,623 Number of Sequences: 53049 Number of extensions: 146782 Number of successful extensions: 393 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 24,988,368 effective HSP length: 75 effective length of database: 21,009,693 effective search space used: 756348948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -