BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_I14 (745 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14261| Best HMM Match : ig (HMM E-Value=0) 28 7.0 SB_48403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_14261| Best HMM Match : ig (HMM E-Value=0) Length = 1337 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = -3 Query: 539 MNVGLGVPNSVLSAP--NLVLTEKNSKEFIVNLS 444 +N+ + P S++ P N++LTE +SKE + N S Sbjct: 687 LNIPVSEPPSIVQFPSKNIILTEGDSKELMCNAS 720 >SB_48403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -1 Query: 196 FYVFTYCYIIYTCCINVSGLFLDDRVPKYF 107 ++ F CY+ C ++ L D RV YF Sbjct: 257 YFAFVICYLPILCSVSYDALTNDHRVSAYF 286 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,470,266 Number of Sequences: 59808 Number of extensions: 343040 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -