BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_I12 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 177 6e-45 SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.59 SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) 28 5.5 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 28 5.5 SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) 28 5.5 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.3 SB_46518| Best HMM Match : VWA (HMM E-Value=1.6e-07) 28 7.3 SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) 28 7.3 SB_53527| Best HMM Match : zf-C3HC4 (HMM E-Value=3.3e-12) 27 9.7 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_26950| Best HMM Match : TBC (HMM E-Value=5.2e-28) 27 9.7 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 177 bits (431), Expect = 6e-45 Identities = 79/141 (56%), Positives = 105/141 (74%) Frame = -1 Query: 616 IAFSGSCVKQSPNMKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRM 437 I GSC+ MK I+A++ V IPD + V VKSR+VTV GPRG LKRNF+HL +++ Sbjct: 544 ICLKGSCLSCIVAMKTILASETVTIPDNVEVKVKSRVVTVTGPRGTLKRNFRHLRLELTK 603 Query: 436 VNPRLLKVEKWFGSKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGN 257 V ++V+ WF S+KELA V+T+ +H+ENMIKGV G++YKMRAVYAHFPIN E Sbjct: 604 VGKDKVRVDVWFASRKELACVKTIITHIENMIKGVIYGYRYKMRAVYAHFPINIAIQENG 663 Query: 256 SIIEIRNFLGEKYIRRVKMAP 194 +++E+RNFLGEKY+RRV+M P Sbjct: 664 TLVEVRNFLGEKYVRRVRMRP 684 >SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1808 Score = 31.5 bits (68), Expect = 0.59 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = -1 Query: 121 SSSAAXMQAXXRQDKKTGEQERDLEGLDEMRKQLL 17 S + + + RQD TG+Q++ LE LD MRK+LL Sbjct: 313 SKNISSKHSSSRQDT-TGDQDKALEKLDMMRKKLL 346 >SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 29.5 bits (63), Expect = 2.4 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 5/87 (5%) Frame = -1 Query: 265 EGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIEGNSLEDVSSSAAXMQAXXR 86 E ++++E K I R+ VT+ + K ++ L+ + LED+ + + Sbjct: 151 EKSTLLEREVNQQNKEIERILSENKVTLADLSKTQENLMKKAKELEDLQQKLLKQEDTAK 210 Query: 85 QDKKTGEQ-----ERDLEGLDEMRKQL 20 QDK+ ++ E++L L E K+L Sbjct: 211 QDKRRLQEVILTKEKELFKLSEEYKEL 237 >SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 416 LQETRVYHANVNSQVFEVPFENSAGPFNCHQ 508 L TR+ + V+S EV E S P++CHQ Sbjct: 160 LYNTRIPNVTVSSDGGEVELEISDDPYDCHQ 190 >SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 363 QTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLKFLLRTPRGPLTVT 506 QT++T A F D RRR F+ +S C + L R+P P++ T Sbjct: 85 QTMITTA--FPDTRKSPLTRRRNFSDGVSDLSCTENLARSPCAPVSPT 130 >SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) Length = 883 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 595 VKQSPNMKQIVANQKVKIPDGLTVHVKSRLVTVKGPRG 482 ++ + +K++ + K K DG+ VH K+ TV+ PRG Sbjct: 98 LQNAKRIKKLEEDLKKKTCDGVLVHRKAVAATVEEPRG 135 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -1 Query: 547 KIPDGLTVHVKSRLVTVKGPRG---VLKRNFKHL-AVDIRMVNPRLLKV 413 K+ DGL VH+ ++ V K P+ + KR + L A+ I + +P + KV Sbjct: 4 KLDDGLRVHIVTQYVLFKNPKKLEIIAKRQKETLEALQINLDHPHVAKV 52 >SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 28.3 bits (60), Expect = 5.5 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +3 Query: 96 ACMXAAELETSSKELPSMISSSFCFGELTTVTPGAIFTLLMYFSPKKLRISIIEL 260 + + AAE++TS L + S S C VT IFT MY P+++ ++ L Sbjct: 230 SAISAAEVKTSRIFLLVINSFSICLAPFMIVTFIEIFTGTMYTVPRQVYLATTNL 284 >SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) Length = 197 Score = 28.3 bits (60), Expect = 5.5 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = +2 Query: 425 TRVYHANVNSQVFEVP-------FENSAGPFNCHQTRFHMDRKP 535 TR YH NV VF V F S G N HQ + DR+P Sbjct: 57 TRSYHENVVRPVFGVSDYWYRYEFAKSRGQINRHQLSWREDRQP 100 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -3 Query: 563 SKSESQNPRRAYGPCEIASGDS*RAPRS--SQKELQTL 456 S+ ++ R Y PC I SG++ APR +KE++ L Sbjct: 1363 SEDDTTTGARRYRPCPIESGNTYEAPRQVVMEKEVEEL 1400 >SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1080 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/59 (32%), Positives = 24/59 (40%) Frame = -1 Query: 202 MAPGVTVVNSPKQKDELIIEGNSLEDVSSSAAXMQAXXRQDKKTGEQERDLEGLDEMRK 26 MA T S K E G+ D S A + DK++GE +D G E RK Sbjct: 370 MASSTTTTTS-KTTLEKGAAGSKTADTSDKATSDNSQKGSDKRSGEASKDGTGAAEKRK 427 >SB_46518| Best HMM Match : VWA (HMM E-Value=1.6e-07) Length = 309 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 138 LPSMISSSFCFGELTTVTPGAIFTLLMYFSPKKLRISIIE 257 +P I S G+L +T G I T PKKL +IE Sbjct: 218 IPIAIGSKVNLGQLNILTAGPIITANTSGDPKKLANQVIE 257 >SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) Length = 1152 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 520 VKSRLVTVKGPRGVLKRNFKHL 455 V++R TV PRG L+RN +HL Sbjct: 1069 VETRSYTVSTPRGELRRNRRHL 1090 >SB_53527| Best HMM Match : zf-C3HC4 (HMM E-Value=3.3e-12) Length = 1290 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 634 MNSAGRIAFSGSCVKQSPNMKQIVAN-QKVKIPDGLTV 524 + SAG +A + +C PN+K+++ + ++K LTV Sbjct: 483 VKSAGAVALAEACCTSLPNLKELILSFDEIKKDAALTV 520 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 27.5 bits (58), Expect = 9.7 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 5/90 (5%) Frame = -1 Query: 394 KKELAAVRTVCSHVENMIKGVTKGFQY-KMRAVYAHFPI--NCVTTEGNSIIE-IRNFLG 227 K+ LAA + V + N+ KGVT+G K R V PI V T+G + + + G Sbjct: 948 KRALAAAKVVKTERVNVAKGVTQGMPVTKGRVVTQGMPITPGRVVTQGKVVTQGMPVTPG 1007 Query: 226 EKYIRRVKMAPGVTVVNS-PKQKDELIIEG 140 + + + PG V P + ++ +G Sbjct: 1008 RVVTQGIPVTPGRIVTQGIPVTQGRVVTQG 1037 >SB_26950| Best HMM Match : TBC (HMM E-Value=5.2e-28) Length = 998 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -1 Query: 169 KQKDELIIEGNSLEDVSSSAAXMQAXXRQDKKTGEQERDL--EGLDEMRKQLLC 14 K+ + +IE N L + S A ++ Q K EQE + + L E+ +QL C Sbjct: 830 KELESYVIEYNVLREEDLSLASVEEFEHQRAKKLEQENKVLSKHLQEVSEQLTC 883 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,893,014 Number of Sequences: 59808 Number of extensions: 409911 Number of successful extensions: 1061 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -