BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H24 (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.11 |||ClC chloride channel |Schizosaccharomyces pombe|c... 31 0.23 SPAC343.05 |vma1||V-type ATPase subunit A|Schizosaccharomyces po... 26 4.9 SPAC607.10 |spo3||sporulation protein Spo3|Schizosaccharomyces p... 25 8.6 SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces ... 25 8.6 SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|... 25 8.6 >SPBC19C7.11 |||ClC chloride channel |Schizosaccharomyces pombe|chr 2|||Manual Length = 812 Score = 30.7 bits (66), Expect = 0.23 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = +3 Query: 72 VATTIVLCTYLDNVYITFVSEIRKSFCTERYY 167 + TT+ Y+ ++ +++S+IR+ +CT +Y Sbjct: 104 IGTTVGFAAYMLDIVTSWLSDIRRGYCTSHWY 135 >SPAC343.05 |vma1||V-type ATPase subunit A|Schizosaccharomyces pombe|chr 1|||Manual Length = 619 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 500 HASLSRKKYINLIMPVYESR 441 + SLS KYIN + P YE R Sbjct: 457 NTSLSYSKYINALQPWYEER 476 >SPAC607.10 |spo3||sporulation protein Spo3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1028 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 500 HASLSRKKYINLIMPVYESRALHAYCVSVVIRIL 399 HA L+R+K + + +YE ++Y V+ +R+L Sbjct: 902 HAGLNRQKPDKIDLDLYEPLPENSYLVAAELRVL 935 >SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1888 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 342 PTRLVCFRKSASYQFLNH*NCFDII 268 PT++ CF Y ++ N FDI+ Sbjct: 1862 PTKIKCFLDKIGYSWMTEENDFDIV 1886 >SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 732 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 95 YLLRQCIHNVCIGNTKIIL 151 YLL+QC+ N+ + N+ I L Sbjct: 652 YLLKQCLSNISLSNSVISL 670 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,901,656 Number of Sequences: 5004 Number of extensions: 59811 Number of successful extensions: 118 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -