BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H24 (745 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18780.1 68417.m02774 cellulose synthase, catalytic subunit (... 28 7.5 At5g54170.1 68418.m06745 expressed protein weak similarity to SP... 27 9.9 >At4g18780.1 68417.m02774 cellulose synthase, catalytic subunit (IRX1) nearly identical to gi:12836997 Length = 985 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -3 Query: 491 LSRKKYINLIMPVYESRALHAYCVSVVIRILNKFL*VTNLLNY*NIHYVRQQGLFVSV 318 L R YIN I+ + S L AYC I +L + L N ++ ++ GLF+S+ Sbjct: 752 LQRLAYINTIVYPFTSLPLVAYCTLPAICLLTGKFIIPTLSNLASMLFL---GLFISI 806 >At5g54170.1 68418.m06745 expressed protein weak similarity to SP|Q9UKL6 Phosphatidylcholine transfer protein (PC-TP) {Homo sapiens} Length = 449 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 586 CQTKSVPAQYESPNNTQCRICLMK*IWCI 500 C TK V PNN Q R+ L WCI Sbjct: 255 CVTKGVSVPSIPPNNKQKRVDLFYSSWCI 283 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,027,040 Number of Sequences: 28952 Number of extensions: 269079 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -