BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H23 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 25 1.6 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 25 2.7 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 24 3.6 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 25.4 bits (53), Expect = 1.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 384 VRTTKGLIENHENIRMCPSQPPLVNTLP 467 ++ KG IE E CP QP T+P Sbjct: 55 LKKRKGAIEELERALSCPGQPSKCVTIP 82 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 24.6 bits (51), Expect = 2.7 Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = +3 Query: 468 SLRVFTLLMPGFLIVTSNLRVKL----KSFLPKLNICITFEALPMIPLCCSRW*STDIGH 635 +L + L +PG + NL + L ++ + C T + ++P CC W S + + Sbjct: 139 ALTLVGLFVPGIITSLLNLLMYLDDARRNRRDRQPCCSTLLCVVVVPFCCRYWHSLRLSY 198 Query: 636 S 638 + Sbjct: 199 A 199 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 499 PGINKVKT-RSDGKVFTSGGWDGHIRIFSWFSMRPLVVLTEHKQAI 365 P + KT +S GKV S WD H F + + ++ +++ +A+ Sbjct: 58 PAPKRGKTQKSAGKVMASVFWDAHGIFFIEYLQKGKIINSDYYKAL 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,523 Number of Sequences: 2352 Number of extensions: 12478 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -