BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H22 (682 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 24 1.0 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 24 1.0 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 4.0 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 21 7.1 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.3 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 24.2 bits (50), Expect = 1.0 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -2 Query: 429 DVAQGIVNAARDDDTKCEVYQAVGPK---RYLLADLVDWFYKLMRKDEKWGGY 280 ++ + +A + +KC Q G + RYL+ + DW+ +L K + G Y Sbjct: 60 ELKNNLADALQTSCSKCSQRQKDGSRTIIRYLIKNKRDWWNELEAKYDPTGIY 112 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 24.2 bits (50), Expect = 1.0 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -2 Query: 429 DVAQGIVNAARDDDTKCEVYQAVGPK---RYLLADLVDWFYKLMRKDEKWGGY 280 ++ + +A + +KC Q G + RYL+ + DW+ +L K + G Y Sbjct: 60 ELKNNLADALQTSCSKCSQRQQDGSRTIIRYLIKNKRDWWNELEAKYDPTGIY 112 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.2 bits (45), Expect = 4.0 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -2 Query: 318 YKLMRKDEKWGGYIRYDMKYDPILPLKVALVNAISPAYPLGNLHWEGIEREATSDN-VVI 142 Y L ++ GG R + Y L + + P P+ G T D+ Sbjct: 147 YHLQDIIDRNGG--RAPLTYHQFLAIIACMGPPPQPEPPVTFNSLNGAHTPLTDDHDEKY 204 Query: 141 GVPTLEDLG 115 GVPTLE+LG Sbjct: 205 GVPTLEELG 213 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 9 EGLVSGTLQADPCSTDGRE-KVSVPTEPGLPCA 104 E V+ L+ PC+ DG E K +P CA Sbjct: 43 ENYVNCLLEKKPCTPDGEELKRVLPDALKTSCA 75 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 134 GTPITTLSEVASLSIPSQ 187 G PITTLS + L +Q Sbjct: 522 GNPITTLSNTSLLGAANQ 539 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,353 Number of Sequences: 336 Number of extensions: 3828 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -