BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H21 (614 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83218-6|CAI58632.1| 273|Caenorhabditis elegans Hypothetical pr... 28 4.6 Z81496-11|CAB04069.2| 448|Caenorhabditis elegans Hypothetical p... 28 6.1 AY204204-1|AAO39205.1| 448|Caenorhabditis elegans nuclear recep... 28 6.1 >Z83218-6|CAI58632.1| 273|Caenorhabditis elegans Hypothetical protein C31A11.10 protein. Length = 273 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +2 Query: 182 LQYNIFRFLNTLEYFKLFFFCDRATLVNCFFFFYNILIRVFD 307 L +I R + TL F +F++ R L+NCF +F+ I I D Sbjct: 99 LSISIERAVATL--FPIFYYNYRQNLLNCFVWFFIICIVSID 138 >Z81496-11|CAB04069.2| 448|Caenorhabditis elegans Hypothetical protein F09C6.9 protein. Length = 448 Score = 27.9 bits (59), Expect = 6.1 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = +2 Query: 164 GSPRQN---LQYNIFRFLNTLEYFKLFFFCDRATLVNCFFFFYNILIRVFDLV*SYFDLK 334 G P+ N Q+ F T+EY K F F R + F +I + +L SY + Sbjct: 250 GGPKHNPDRKQWMYFNLFTTVEYAKTFMFFHRLDSRDKFILTKHITLSCMNLHLSYISVA 309 Query: 335 KPTFI*RDNDYARFLS 382 + + + + D F S Sbjct: 310 RKSEVLTNPDGTSFPS 325 >AY204204-1|AAO39205.1| 448|Caenorhabditis elegans nuclear receptor NHR-116 protein. Length = 448 Score = 27.9 bits (59), Expect = 6.1 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = +2 Query: 164 GSPRQN---LQYNIFRFLNTLEYFKLFFFCDRATLVNCFFFFYNILIRVFDLV*SYFDLK 334 G P+ N Q+ F T+EY K F F R + F +I + +L SY + Sbjct: 250 GGPKHNPDRKQWMYFNLFTTVEYAKTFMFFHRLDSRDKFILTKHITLSCMNLHLSYISVA 309 Query: 335 KPTFI*RDNDYARFLS 382 + + + + D F S Sbjct: 310 RKSEVLTNPDGTSFPS 325 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,104,577 Number of Sequences: 27780 Number of extensions: 146710 Number of successful extensions: 301 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 301 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -