BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H19 (457 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36160.1 68415.m04438 40S ribosomal protein S14 (RPS14A) 177 4e-45 At3g11510.1 68416.m01403 40S ribosomal protein S14 (RPS14B) simi... 176 5e-45 At3g52580.1 68416.m05790 40S ribosomal protein S14 (RPS14C) ribo... 175 9e-45 At1g31817.1 68414.m03907 chloroplast 30S ribosomal protein S11, ... 36 0.013 At1g35920.1 68414.m04461 hypothetical protein includes At5g34960... 31 0.37 At5g34960.1 68418.m04125 hypothetical protein includes At5g34960... 29 2.0 At2g14450.1 68415.m01617 hypothetical protein includes At5g34960... 29 2.0 At5g04480.1 68418.m00447 expressed protein 28 2.6 At5g53640.1 68418.m06663 F-box family protein contains F-box dom... 27 6.0 At5g12370.1 68418.m01455 exocyst complex component Sec10-related... 27 6.0 At2g15620.1 68415.m01789 ferredoxin--nitrite reductase, putative... 27 6.0 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 27 7.9 At1g52780.1 68414.m05966 expressed protein 27 7.9 >At2g36160.1 68415.m04438 40S ribosomal protein S14 (RPS14A) Length = 150 Score = 177 bits (430), Expect = 4e-45 Identities = 84/108 (77%), Positives = 94/108 (87%) Frame = -3 Query: 395 MAPRKNKVAKEEVQVTLGPQHLVGETVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGM 216 M+ RK K K +V VTLGP GE VFGV HIFASFNDTF+HVTDLSGRET+ R+TGGM Sbjct: 1 MSKRKTKEPKVDV-VTLGPSVREGEQVFGVVHIFASFNDTFIHVTDLSGRETLVRITGGM 59 Query: 215 KVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTP 72 KVKADRDE+SPYAAMLAAQDVA++CK LGITA+H+KLRATGGNKTKTP Sbjct: 60 KVKADRDESSPYAAMLAAQDVAQRCKELGITAMHVKLRATGGNKTKTP 107 Score = 50.8 bits (116), Expect = 4e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -1 Query: 85 KQRXPGPGAQSALRAIARSSMKIGRIED 2 K + PGPGAQSALRA+ARS MKIGRIED Sbjct: 103 KTKTPGPGAQSALRALARSGMKIGRIED 130 >At3g11510.1 68416.m01403 40S ribosomal protein S14 (RPS14B) similar to 40S ribosomal protein S14 GB:P19950 [Zea mays] Length = 150 Score = 176 bits (429), Expect = 5e-45 Identities = 84/108 (77%), Positives = 93/108 (86%) Frame = -3 Query: 395 MAPRKNKVAKEEVQVTLGPQHLVGETVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGM 216 M+ RK K K E VTLGP GE VFGV HIFASFNDTF+HVTDLSGRET+ R+TGGM Sbjct: 1 MSKRKTKEPKVET-VTLGPSVREGEQVFGVVHIFASFNDTFIHVTDLSGRETLVRITGGM 59 Query: 215 KVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTP 72 KVKADRDE+SPYAAMLAAQDVA++CK LGITA+H+KLRATGGNKTKTP Sbjct: 60 KVKADRDESSPYAAMLAAQDVAQRCKELGITAMHVKLRATGGNKTKTP 107 Score = 50.8 bits (116), Expect = 4e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -1 Query: 85 KQRXPGPGAQSALRAIARSSMKIGRIED 2 K + PGPGAQSALRA+ARS MKIGRIED Sbjct: 103 KTKTPGPGAQSALRALARSGMKIGRIED 130 >At3g52580.1 68416.m05790 40S ribosomal protein S14 (RPS14C) ribosomal protein S14 -Zea mays,PIR2:A30097 Length = 150 Score = 175 bits (427), Expect = 9e-45 Identities = 83/108 (76%), Positives = 93/108 (86%) Frame = -3 Query: 395 MAPRKNKVAKEEVQVTLGPQHLVGETVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGM 216 M+ RK K K E VTLGP GE VFGV H+FASFNDTF+HVTDLSGRET+ R+TGGM Sbjct: 1 MSKRKTKEPKVE-NVTLGPAVREGEQVFGVVHVFASFNDTFIHVTDLSGRETLVRITGGM 59 Query: 215 KVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTP 72 KVKADRDE+SPYAAMLAAQDVA++CK LGITA+H+KLRATGGNKTKTP Sbjct: 60 KVKADRDESSPYAAMLAAQDVAQRCKELGITAIHVKLRATGGNKTKTP 107 Score = 50.8 bits (116), Expect = 4e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -1 Query: 85 KQRXPGPGAQSALRAIARSSMKIGRIED 2 K + PGPGAQSALRA+ARS MKIGRIED Sbjct: 103 KTKTPGPGAQSALRALARSGMKIGRIED 130 >At1g31817.1 68414.m03907 chloroplast 30S ribosomal protein S11, putative contains Pfam profile: PF00411: Ribosomal protein S11 Length = 314 Score = 35.9 bits (79), Expect = 0.013 Identities = 19/73 (26%), Positives = 35/73 (47%) Frame = -3 Query: 323 ETVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEK 144 ET + HI N+TFV VTD G +G + + + Y A A+++ + Sbjct: 190 ETNADIIHIKMLRNNTFVTVTDSKGNVKCKATSGSLPDLKGGRKMTNYTADATAENIGRR 249 Query: 143 CKTLGITALHIKL 105 K +G+ ++ +K+ Sbjct: 250 AKAMGLKSVVVKV 262 >At1g35920.1 68414.m04461 hypothetical protein includes At5g34960, At2g14450, At1g35920 Length = 567 Score = 31.1 bits (67), Expect = 0.37 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 143 CKTLGITALHIKLRATG-GNKTKTPWSWCSVCTS 45 CKT HI G NK K P WC CTS Sbjct: 293 CKTCNKKVNHIHAGVNGVNNKGKKPRFWCDTCTS 326 >At5g34960.1 68418.m04125 hypothetical protein includes At5g34960, At2g14450, At1g35920 Length = 1033 Score = 28.7 bits (61), Expect = 2.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = -3 Query: 143 CKTLGITALHIKLRATG-GNKTKTPWSWCSVCTS 45 CKT HI G NK K P WC C S Sbjct: 282 CKTCNKKVNHIHAGVNGVNNKGKKPKFWCDTCKS 315 >At2g14450.1 68415.m01617 hypothetical protein includes At5g34960, At2g14450, At1g35920 Length = 544 Score = 28.7 bits (61), Expect = 2.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = -3 Query: 143 CKTLGITALHIKLRATG-GNKTKTPWSWCSVCTS 45 CKT HI G NK K P WC C S Sbjct: 283 CKTCNKKVNHIHAGVNGVNNKGKKPRFWCETCKS 316 >At5g04480.1 68418.m00447 expressed protein Length = 1050 Score = 28.3 bits (60), Expect = 2.6 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -3 Query: 125 TALHIKLRATGGNKTKTPWSWCSVCTSGXCSFKYED 18 T L I A G T WS C + G C +ED Sbjct: 813 TRLDIDGDAYGSKNALTFWSMCDILNQGNCRTTFED 848 >At5g53640.1 68418.m06663 F-box family protein contains F-box domain Pfam:PF00646 Length = 917 Score = 27.1 bits (57), Expect = 6.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 374 LCFFSGPWLSL*LESCQNLKA 436 LC + WL LESC NLK+ Sbjct: 807 LCIYDLKWLPTFLESCPNLKS 827 >At5g12370.1 68418.m01455 exocyst complex component Sec10-related low similarity to SP|O00471 Exocyst complex component Sec10 (hSec10) {Homo sapiens} Length = 858 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 227 TGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITA 120 +GG+++K D +E + A V EK + LGI A Sbjct: 777 SGGLRLKRDLNEYVGFVKSFGAPSVDEKFELLGIIA 812 >At2g15620.1 68415.m01789 ferredoxin--nitrite reductase, putative strong similarity to ferredoxin--nitrite reductase [Nicotiana tabacum] GI:19893; contains Pfam profiles PF03460: Nitrite/Sulfite reductase ferredoxin-like half domain, PF01077: Nitrite and sulphite reductase 4Fe-4S domain Length = 586 Score = 27.1 bits (57), Expect = 6.0 Identities = 22/74 (29%), Positives = 29/74 (39%) Frame = -3 Query: 284 NDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKL 105 ND + GR + GG +EA P A + A DV CK + + L Sbjct: 265 NDLAYMPANKDGRFGFNLLVGGFFSPKRCEEAIPLDAWVPADDVLPLCK--AVLEAYRDL 322 Query: 104 RATGGNKTKTPWSW 63 T GN+ KT W Sbjct: 323 -GTRGNRQKTRMMW 335 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 26.6 bits (56), Expect = 7.9 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 7/84 (8%) Frame = -3 Query: 419 SSQAKG*AMAPRKNKVAKEEVQVTLGPQHLVGET----VFGVAHIFASFNDTFVHVTDLS 252 +SQ++G A RK+++ + + + G+ FG F +F D VHV+ LS Sbjct: 110 TSQSRGTARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLS 169 Query: 251 G---RETIARVTGGMKVKADRDEA 189 ++ + VT G +VK EA Sbjct: 170 DNFVKDVSSVVTIGQEVKVRLVEA 193 >At1g52780.1 68414.m05966 expressed protein Length = 1059 Score = 26.6 bits (56), Expect = 7.9 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -3 Query: 200 RDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPWSWCSVCTSGXCSFKYE 21 RDE++P + DV +KCK++ +A +KL + ++TP + F+Y Sbjct: 43 RDESAPKISYDRINDVKKKCKSVLSSASELKLE----DISRTPRK-----SKRNLGFRYG 93 Query: 20 DW 15 DW Sbjct: 94 DW 95 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,423,790 Number of Sequences: 28952 Number of extensions: 219422 Number of successful extensions: 533 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 752336160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -