BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H16 (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) 49 3e-06 SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) Length = 112 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = -3 Query: 174 PFAFNSCPLRRIPQRYVIGTSTRISLGNXKLPKH 73 PF N PLRRIPQ YVI TST I + + KLP+H Sbjct: 2 PFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEH 35 >SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -2 Query: 283 TQPEDRNCLHSPRW*TCRQEGCTCWN-SAQRSAFSYWTFCFQFVPATPYS 137 TQ R HSPR CR CT +N + S+ T C + P +S Sbjct: 84 TQEAYRKNSHSPRKRQCRNRLCTSYNWIRNKETSSFVTLCHREKPVGHFS 133 >SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -2 Query: 391 NQNSTPQ---T*EVLLPHSGENPCFIWWPSIQQACTQDPTQP 275 NQ++ PQ T VL+PH G PC +P+ TQP Sbjct: 94 NQSTLPQGNATQWVLIPHKGSMPCIGTFPNAINTWIIPGTQP 135 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,983,288 Number of Sequences: 59808 Number of extensions: 401324 Number of successful extensions: 1138 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1118 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -