BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H12 (577 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces ... 26 3.4 SPBC32H8.08c |||mannosyltransferase complex subunit |Schizosacch... 26 4.5 SPAC22H10.08 |||DUF2009 protein|Schizosaccharomyces pombe|chr 1|... 26 4.5 >SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2111 Score = 26.2 bits (55), Expect = 3.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 287 PQHLSRMIGCLYPEQKLILERQ 222 P+HLSR + L E K +LER+ Sbjct: 1540 PRHLSRFVKVLPREYKAVLERE 1561 >SPBC32H8.08c |||mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 25.8 bits (54), Expect = 4.5 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 413 VITENAVNLVKTKYAPTSTYHKSCEFF 493 +I E+ V YA +YHK C FF Sbjct: 180 MIDESIAEQVGVVYANFPSYHKMCRFF 206 >SPAC22H10.08 |||DUF2009 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 492 Score = 25.8 bits (54), Expect = 4.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 89 QKHNILM*KIIKIGTHYKSINPYSINVHTQGSILY 193 ++H KI +IG YK +NP + T G ++Y Sbjct: 115 EQHAEFFKKIFEIGRRYKVLNPNRLG-STYGKLMY 148 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,262,557 Number of Sequences: 5004 Number of extensions: 44749 Number of successful extensions: 84 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -