BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H12 (577 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38443| Best HMM Match : Lipoprotein_15 (HMM E-Value=0.14) 30 1.2 SB_57704| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_38443| Best HMM Match : Lipoprotein_15 (HMM E-Value=0.14) Length = 310 Score = 30.3 bits (65), Expect = 1.2 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -3 Query: 260 CLYPEQKLILERQCKTRCFKNVHIIYS 180 C +P + I +++C CF++ H++YS Sbjct: 53 CAWPLYRYICDKKCDGICFRDHHVVYS 79 >SB_57704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.5 bits (58), Expect = 8.3 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = -2 Query: 132 VPILIIFYIKMLCFCFLVTFFVIXLNSKILLVI 34 V I+IIF + ++ FCF+ + + + S +L+++ Sbjct: 34 VVIIIIFIVVVVVFCFINIYVICDILSPVLMMM 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,828,412 Number of Sequences: 59808 Number of extensions: 309820 Number of successful extensions: 458 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -