BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H09 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15823| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_25763| Best HMM Match : MgtE_N (HMM E-Value=1.9) 32 0.54 SB_1079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_21869| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_14700| Best HMM Match : MbeB_N (HMM E-Value=1.8) 29 2.9 SB_10164| Best HMM Match : Keratin_B2 (HMM E-Value=3.4) 29 5.1 SB_183| Best HMM Match : IBR (HMM E-Value=0.015) 29 5.1 SB_31681| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_19401| Best HMM Match : Rop (HMM E-Value=3) 28 8.9 SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_24229| Best HMM Match : Fukutin-related (HMM E-Value=0.61) 28 8.9 >SB_15823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 48.8 bits (111), Expect = 4e-06 Identities = 40/168 (23%), Positives = 78/168 (46%), Gaps = 7/168 (4%) Frame = -2 Query: 564 ISLEHEILLHPKYFGPQLLETVKQKLYTDVEGTCTGKYGFVIAVTQIDNIGAGLIQHGQG 385 + ++ + L PKY +++ V+ ++ + V G CT + G+V++V ++ + + Sbjct: 249 VVIKRRLFLDPKYLDSEIMNHVRDEIVSTVVGECTRELGWVLSVGRLTEV-VNVCD---- 303 Query: 384 FVMYPVKYKAVVFRPFKGEVLDGIVTQVNKVGMFAQIGPL-KCFISHHSIPDYM-EFCPN 211 ++ V ++ RP G L G V V G+ ++ + K I S+ Y+ E C N Sbjct: 304 -TIFRVSFEVETLRPRVGGELVGEVRMVWAGGVLLEVSDIQKVVIPSTSLDGYVFEACSN 362 Query: 210 VNPPCY-----KSKQEDSVIQEEDVIRLKIVGTRVDASGIFAIGTLIG 82 CY + K+ D+V+ +R++ G VD G+ A +G Sbjct: 363 ----CYVREGERIKEGDTVLVTVTTVRMERFG--VDVDGVMAYAARVG 404 >SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 32.3 bits (70), Expect = 0.41 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 5/85 (5%) Frame = +2 Query: 278 CANMPTLFTCVTIPSK--TSPLNGLNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAI 442 C + T +TIP T+P L T L LT +T PC P +L+ + Sbjct: 492 CLVLTTPCLVLTIPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVL 551 Query: 443 TNPYLPVQVPSTSVYSFCLTVSNSC 517 T P L + P + + CL ++ C Sbjct: 552 TTPCLVLTTPCLVLTTPCLVLTTPC 576 Score = 31.5 bits (68), Expect = 0.72 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 326 TSPLNGLNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFC 496 T+P L T L LT +T PC P +L+ +T P L + P + S C Sbjct: 559 TTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPGLVLTTPGLVLTSPC 618 Query: 497 LTVSNSC 517 L ++ C Sbjct: 619 LVLTTPC 625 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 326 TSPLNGLNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFC 496 T+P L T L LT +T PC P +L+ +T P L + P + + C Sbjct: 517 TTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPC 576 Query: 497 LTVSNSC 517 L ++ C Sbjct: 577 LVLTTPC 583 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 326 TSPLNGLNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFC 496 T+P L T L LT +T PC P +L+ +T P L + P + + C Sbjct: 524 TTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPC 583 Query: 497 LTVSNSC 517 L ++ C Sbjct: 584 LVLTTPC 590 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 326 TSPLNGLNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFC 496 T+P L T L LT +T PC P +L+ +T P L + P + + C Sbjct: 531 TTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPC 590 Query: 497 LTVSNSC 517 L ++ C Sbjct: 591 LVLTTPC 597 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +2 Query: 344 LNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFCLTVSNS 514 L T L LT +T PC P +L+I +T P L + P + + CL ++ Sbjct: 474 LTTPCLVLTTPCLVLTTPCLVLTTPCLVLTIPCLVLTTPCLVLTTPCLVLTTPCLVLTTP 533 Query: 515 C 517 C Sbjct: 534 C 534 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +2 Query: 326 TSPLNGLNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFC 496 T+P L T L LT +T PC P +L+ +T+P L + P + + C Sbjct: 573 TTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPGLVLTTPGLVLTSPCLVLTTPCLVLTTPC 632 Query: 497 LTVSNSC 517 L ++ C Sbjct: 633 LVLTTPC 639 Score = 29.5 bits (63), Expect = 2.9 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 326 TSPLNGLNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFC 496 T+P L T L LT +T PC P +L+ +T P L + P + + C Sbjct: 489 TTPCLVLTTPCLVLTIPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPCLVLTTPC 548 Query: 497 LTVSNSC 517 L ++ C Sbjct: 549 LVLTTPC 555 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = +2 Query: 326 TSPLNGLNTTALYLTG---YMTNPCPCCMRPAPILSI*VTAITNPYLPVQVPSTSVYSFC 496 T+P L T L LT +T+PC P +L+ +T P L + + S + +FC Sbjct: 594 TTPCLVLTTPGLVLTTPGLVLTSPCLVLTTPCLVLTTPCLVLTTPCLVLTILSLVLGTFC 653 >SB_25763| Best HMM Match : MgtE_N (HMM E-Value=1.9) Length = 483 Score = 31.9 bits (69), Expect = 0.54 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWSTKFCYIRNISVHNYWRQSN 495 W+ N ST + CST +WST N S HN W N Sbjct: 358 WSILNNWSTYDNCSTYNNWSTH----NNWSTHNNWSTYN 392 Score = 31.1 bits (67), Expect = 0.95 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWSTKFCYIRNISVHNYW-RQSNRSYTLMWKAP 465 W+T N ST ST +WST N S HN W +N Y K P Sbjct: 70 WSTYNNWSTYNNWSTYHNWST----YNNWSTHNNWSTYNNWRYLQQLKCP 115 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWSTKFCYIRNISVHNYWRQSN 495 W+T+ N ST ST +WST N S HN W N Sbjct: 304 WSTHNNWSTYNNWSTHNNWST----YNNWSTHNNWSTYN 338 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWST--KFCYIRNISVHNYW-RQSNRSYTLMWKA 468 W+T+ N ST ST +WST + N S HN W N S W A Sbjct: 376 WSTHNNWSTHNNWSTYNNWSTYNNWSTYDNWSTHNNWSTHDNWSNHNNWSA 426 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWSTKFCYIRNISVHNYW 507 W+T+ N ST ST +WST N S HN W Sbjct: 328 WSTHNNWSTYNNWSTHNNWST----YNNWSTHNNW 358 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWST--KFCYIRNISVHNYWRQSN 495 W+T N ST ST +WST + N S +N W N Sbjct: 58 WSTYNNWSTYNNWSTYNNWSTYNNWSTYHNWSTYNNWSTHN 98 >SB_1079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 0.72 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWST--KFCYIRNISVHNYWRQSN 495 W+T+ N ST ST +WST + N S HN W N Sbjct: 30 WSTHNNWSTYNNWSTHNNWSTYNNWSTYNNWSTHNNWSTYN 70 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWSTKFCYIRNISVHNYWRQSN 495 W+T+ N ST ST +WST N S HN W N Sbjct: 60 WSTHNNWSTYNNWSTHNNWST----YNNWSTHNNWSTYN 94 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 611 WNTNRNLSTAEKCSTTFHWSTKFCYIRNISVHNYWRQSN 495 W+T+ N ST ST +W+T+ N S HN W N Sbjct: 84 WSTHNNWSTYNNWSTHNNWNTR----NNWSTHNNWSTYN 118 >SB_21869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1123 Score = 29.9 bits (64), Expect = 2.2 Identities = 30/113 (26%), Positives = 50/113 (44%) Frame = -1 Query: 676 VLRVDAVYVYYXXITIKQI*LNGILIVICPPLKNVLPHFIGARNFVTSEIFRSTTIGDSQ 497 +L + AV ++ I + I + IL V+C L + + +G I S +G S Sbjct: 921 ILCMVAVVIFTGHILLSIIVMLTILGVLC--LVVGVFYLVGWHLGAVEAISLSILVGTSV 978 Query: 496 TEAIH*CGRHLYWQIWICDSGNSNRQYRSWSHTTWTRVCHVPC*IQSCCV*TI 338 +H ++ +I DSG SN++ R W + + H+ I S V TI Sbjct: 979 DYCVHLIDGYIIAGRFIPDSGLSNKEVRRWRAS--AAISHIGSSILSSAVTTI 1029 >SB_14700| Best HMM Match : MbeB_N (HMM E-Value=1.8) Length = 815 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 342 PFKGEVLDGIVTQVNKVGMFAQIGPLKCFISHHSIPD 232 PF +LD ++ + + L C +SHHS+PD Sbjct: 275 PFGRPLLDSLMEYYLNIRDIQTLAVLTCVMSHHSLPD 311 >SB_10164| Best HMM Match : Keratin_B2 (HMM E-Value=3.4) Length = 428 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 406 SHTTWTRVCHVPC*IQ-SCCV*TIQRRSFRWYCHTSK*GWHV 284 S T W +CH PC +Q + V R+ R CH + G HV Sbjct: 315 SRTLWAIICHAPCGLQVTHLVGYYMSRTLRATCH-APCGLHV 355 >SB_183| Best HMM Match : IBR (HMM E-Value=0.015) Length = 228 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 265 ERSYLRKHANLIYLCDNTI*N---FSFEWSKHNSFVFNRVHDKPLSMLYETSSD 417 E +LRK +++ LC NT+ F+F ++N V + K L M ET S+ Sbjct: 104 EVQFLRKAVDVLCLCRNTLKYTYVFAFYLKRNNQSVIFEDNQKDLEMATETLSE 157 >SB_31681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = -2 Query: 471 GTCTGKYGFVIAVTQIDNIGAGLIQHGQGFVMYPVKYK 358 G + K G IAV ++ I AG+ + G+G+++Y V+Y+ Sbjct: 103 GGSSVKRGDQIAVGALEGINAGIWEKGRGYLVY-VRYE 139 >SB_19401| Best HMM Match : Rop (HMM E-Value=3) Length = 451 Score = 27.9 bits (59), Expect = 8.9 Identities = 19/59 (32%), Positives = 33/59 (55%) Frame = +3 Query: 33 IVLHQFQVIVVLIPNSLQLKSRLQKCHSRQLSYQQSLIGSHPLLVLRYPLVYSYNMEDL 209 IV+ F +I L+ L++K ++ K H+ + + S +GS +LV+ + L YS DL Sbjct: 38 IVVAAFVLITSLLMQ-LRIKVKI-KTHAGRFIFNSSHLGSEFVLVVPHVLPYSEESSDL 94 >SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/70 (21%), Positives = 32/70 (45%) Frame = +3 Query: 36 VLHQFQVIVVLIPNSLQLKSRLQKCHSRQLSYQQSLIGSHPLLVLRYPLVYSYNMEDLH* 215 V+H ++ L P + L + H ++ ++I HP ++ +P V + + +H Sbjct: 27 VIHLHPTVIFLHPTVIHLHPTVLNLHPTIINLHPTVIHIHPTVIHLHPTVINLHPTVIH- 85 Query: 216 GRTPYSLVLN 245 P+ V+N Sbjct: 86 ---PHPTVIN 92 >SB_24229| Best HMM Match : Fukutin-related (HMM E-Value=0.61) Length = 604 Score = 27.9 bits (59), Expect = 8.9 Identities = 19/59 (32%), Positives = 33/59 (55%) Frame = +3 Query: 33 IVLHQFQVIVVLIPNSLQLKSRLQKCHSRQLSYQQSLIGSHPLLVLRYPLVYSYNMEDL 209 IV+ F +I L+ L++K ++ K H+ + + S +GS +LV+ + L YS DL Sbjct: 251 IVVAAFVLITSLLMQ-LRIKVKI-KTHAGRFIFNSSHLGSEFVLVVPHVLPYSEESSDL 307 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,238,923 Number of Sequences: 59808 Number of extensions: 483260 Number of successful extensions: 1552 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1525 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -