BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H08 (609 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: L... 39 0.11 UniRef50_Q5AH76 Cluster: Putative uncharacterized protein; n=1; ... 36 0.75 UniRef50_A2EGL1 Cluster: Oxidoreductase, short chain dehydrogena... 32 9.3 >UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: Like moricin - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 248 Score = 38.7 bits (86), Expect = 0.11 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 601 MGXGDHSPSGGPYARLPTRA 542 MG G+HSPSG PYA LPTRA Sbjct: 1 MGDGNHSPSGRPYASLPTRA 20 >UniRef50_Q5AH76 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 516 Score = 35.9 bits (79), Expect = 0.75 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 35 RLKIHKYTFNVDYKLT*TL-FGLNKTGGVITSKQHVWTFFLHNNDS 169 R K+H + N +YKL+ L F + K G +I +K + F NNDS Sbjct: 128 RKKLHNFKCNFNYKLSCNLKFNIKKKGNIIANKYLLLKIFYVNNDS 173 >UniRef50_A2EGL1 Cluster: Oxidoreductase, short chain dehydrogenase/reductase family protein; n=1; Trichomonas vaginalis G3|Rep: Oxidoreductase, short chain dehydrogenase/reductase family protein - Trichomonas vaginalis G3 Length = 271 Score = 32.3 bits (70), Expect = 9.3 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 495 QLNYLNFEYDRVTVRSLVFKTALCSASTVSRCSHCIFIFVA 373 Q++YL +YD V ++ F +A+ + +S SHC +FV+ Sbjct: 102 QVSYLQMKYDISKVININFLSAVTTFEAISPSSHCSAVFVS 142 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,788,371 Number of Sequences: 1657284 Number of extensions: 10632272 Number of successful extensions: 20825 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20820 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43562448615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -