BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H06 (446 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_45809| Best HMM Match : Vicilin_N (HMM E-Value=4.5) 31 0.43 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 30 0.76 SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) 30 1.0 SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_16982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) 29 1.8 SB_16838| Best HMM Match : TolA (HMM E-Value=2) 29 1.8 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 29 1.8 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 29 1.8 SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) 29 2.3 SB_2460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_54706| Best HMM Match : Linker_histone (HMM E-Value=0.014) 28 3.1 SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 28 4.0 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 28 4.0 SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_21618| Best HMM Match : Yip1 (HMM E-Value=1.1) 28 4.0 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_50629| Best HMM Match : Extensin_2 (HMM E-Value=0.94) 27 5.3 SB_34735| Best HMM Match : NUDIX (HMM E-Value=6.1) 27 5.3 SB_31651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 27 5.3 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 27 5.3 SB_6936| Best HMM Match : TP2 (HMM E-Value=1.1) 27 5.3 SB_1355| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_52016| Best HMM Match : Cystatin (HMM E-Value=0.87) 27 5.3 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 27 5.3 SB_22132| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 27 5.3 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) 27 7.1 SB_48266| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_12095| Best HMM Match : Vicilin_N (HMM E-Value=0.083) 27 7.1 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_645| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_35402| Best HMM Match : Collagen (HMM E-Value=0.39) 27 7.1 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_9492| Best HMM Match : Rho_N (HMM E-Value=2.1e-12) 27 7.1 SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 32.7 bits (71), Expect = 0.14 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 6/85 (7%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHEQQRLSGLQE---RSQRNEPRARPPQSGPEREC---VQERGP 268 + ++ K R+R ER +QQ+L +E R Q+ E + R + ++ QER Sbjct: 177 RSQNEERKRREREQKEREKQQKLDMEKEERRRRQQEEEKKRREEEEKRKKVEKEKQEREK 236 Query: 269 CARRR*IQSEHQQRSRQCA*YRQIP 343 A++ + + QQR+ Q R+IP Sbjct: 237 AAKKNIKRQQQQQRTDQQQYPREIP 261 >SB_45809| Best HMM Match : Vicilin_N (HMM E-Value=4.5) Length = 215 Score = 31.1 bits (67), Expect = 0.43 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRAR 220 +ER R +K RDR+ R +R S ER R + R+R Sbjct: 33 RERRRRSKSRDRDSRSRTSSRRRSRSSERRHRKDDRSR 70 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 31.1 bits (67), Expect = 0.43 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRAR 220 +ER R +K RDR+ R +R S ER R + R+R Sbjct: 1603 RERRRRSKSRDRDSRSRTSSRRRSRSSERRHRKDDRSR 1640 >SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 942 Score = 31.1 bits (67), Expect = 0.43 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = +2 Query: 113 RHRPTKLRDRNPS--ERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR* 286 R R TK + ++PS R + R S ER R R+R P+S R + RRR Sbjct: 312 RERNTKRKSKSPSLERRRSRARRSRSIERRDRRRSRSRSPRSSLGRSRRRSSSRNRRRRR 371 Query: 287 IQSEHQQRSR-QCA*YRQIPREST 355 +S+ ++ QC +++ R + Sbjct: 372 SRSKSPLNTKSQCEKEQRVSRSKS 395 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 30.7 bits (66), Expect = 0.57 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 137 DRNPSERHEQQRLSG-LQERSQRNEPRARPPQSGPERECVQERGPCA 274 D PS E G +Q + +R R+ PP++G + + + ERGP A Sbjct: 1340 DSEPSHAKESASGRGSVQAKKRRTSSRSVPPRAGEDPKAMIERGPDA 1386 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 30.3 bits (65), Expect = 0.76 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%) Frame = +2 Query: 107 KERHRPTKLRDRNPSE--RHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARR 280 K R R + R R+P + R ++R ++RS+ R+R P+ G + R P RR Sbjct: 191 KSRSRSPRKRSRSPRKMLRSPRKRSRTPRKRSRSPRKRSRSPRKGSHTPKKRSRSP--RR 248 Query: 281 R*IQSEHQQRSR 316 H++RSR Sbjct: 249 N--SQRHKERSR 258 Score = 27.5 bits (58), Expect = 5.3 Identities = 20/84 (23%), Positives = 34/84 (40%) Frame = +2 Query: 101 SPKERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARR 280 SP++R R + R R+P +R R + + PR R Q ER +R Sbjct: 210 SPRKRSRTPRKRSRSPRKRSRSPRKGSHTPKKRSRSPR-RNSQRHKERSRYHRSRSRSRH 268 Query: 281 R*IQSEHQQRSRQCA*YRQIPRES 352 R +S + +++ R+S Sbjct: 269 RRSRSNSPSMRKSDRKFKKSQRKS 292 Score = 26.6 bits (56), Expect = 9.3 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = +2 Query: 101 SPKERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEP--RARPPQSGPERECVQERGPCA 274 SP++ R + R R P +R R R + P R+R P+ +R +ER Sbjct: 203 SPRKMLRSPRKRSRTPRKRSRSPRKRSRSPRKGSHTPKKRSRSPRRNSQRH--KERSRYH 260 Query: 275 RRR*IQSEHQQRSR 316 R R +S H +RSR Sbjct: 261 RSR-SRSRH-RRSR 272 >SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) Length = 1072 Score = 29.9 bits (64), Expect = 1.0 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = +2 Query: 107 KERHRPTKLRDRNPS-ERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR 283 +E + K ++R ER +QR +E R R+ P R + + P +RRR Sbjct: 997 EEEEKKEKEQEREKERERLREQREKEREETRMRARDRSGDRARSPPRGRARSKSPVSRRR 1056 Query: 284 *IQSEHQQRSR 316 S + RSR Sbjct: 1057 ASPSRSRSRSR 1067 >SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 29.9 bits (64), Expect = 1.0 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 143 NPSERHEQQRLSGLQERSQRNEPRARPPQSGP 238 NPS++ +++ + E +R EP P++GP Sbjct: 397 NPSQKKDEEEMEEEDEEEEREEPDEPEPETGP 428 >SB_16982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 29.5 bits (63), Expect = 1.3 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 149 SERHEQQRLSGLQERSQRNEPRARPPQSGPER 244 SER ++R SGLQERS+ R+R P+ R Sbjct: 203 SERTRKRRHSGLQERSRDRIARSRSPRRSRAR 234 >SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) Length = 426 Score = 29.1 bits (62), Expect = 1.8 Identities = 21/70 (30%), Positives = 29/70 (41%) Frame = +2 Query: 110 ERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*I 289 ER RP+ L R+ SER R+S RS + + P R +R AR R Sbjct: 47 ERKRPSSL-GRDSSERRPSARVSSDNSRSPPHRRDSSRRSHSPSRRSSDDRSTDARDRRD 105 Query: 290 QSEHQQRSRQ 319 + R R+ Sbjct: 106 RRRSSSRERR 115 >SB_16838| Best HMM Match : TolA (HMM E-Value=2) Length = 371 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQ-SGPERECVQER 262 +++ R + + R P +R +QQ+ Q++SQ+ + + +P Q S ++E Q R Sbjct: 82 QQQQRRQQQQKRQPQQRRQQQQQRQPQQKSQQQQQQQQPQQPSHGQQEPHQRR 134 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 29.1 bits (62), Expect = 1.8 Identities = 23/59 (38%), Positives = 30/59 (50%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR 283 +ER RP +RDR E +R +R+ R RAR + ERE V+ER P R R Sbjct: 524 QERDRP--VRDRETYRDRELER-----DRADRERERARDTRRDRERERVRER-PRERER 574 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +2 Query: 101 SPKERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERG 265 SP+ R R R R+P ++ R G ++R R+ R R G +R+ +++G Sbjct: 448 SPRRRSRSPGHRSRSPRRGRDRDRDRG-RDRRDRDRDRDRDRDRGRDRDRDKDKG 501 >SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 794 Score = 28.7 bits (61), Expect = 2.3 Identities = 22/82 (26%), Positives = 34/82 (41%) Frame = +2 Query: 110 ERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*I 289 ER R K R+R E++R + +R R R + ERE +ER R Sbjct: 205 ERQRE-KERERERERERERERERERERERERERERERERERERERERERERERERERERE 263 Query: 290 QSEHQQRSRQCA*YRQIPREST 355 + ++R R+ Y + ST Sbjct: 264 RERERERERERKRYACVSETST 285 >SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 28.7 bits (61), Expect = 2.3 Identities = 21/70 (30%), Positives = 29/70 (41%) Frame = +2 Query: 110 ERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*I 289 ER RP+ L R+ SER R+S RS + + P R +R AR R Sbjct: 47 ERKRPSSL-GRDSSERRPSVRVSSDNSRSPPHRRDSSRRSHSPSRRSSDDRSTDARDRRD 105 Query: 290 QSEHQQRSRQ 319 + R R+ Sbjct: 106 RRRSSSRERR 115 >SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) Length = 2128 Score = 28.7 bits (61), Expect = 2.3 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 5/89 (5%) Frame = +2 Query: 104 PKERHRPTKLRDRNPS----ERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPC 271 PKE R R R PS +RHE +R G E +R + R ER+ + R Sbjct: 1595 PKEEPRQGTERRREPSLRHDDRHEDRRSEGRPEDYERRDEERR---REAERKGERPREEF 1651 Query: 272 ARRR*IQSEHQQRS-RQCA*YRQIPREST 355 R+ S+ QRS R+ Y + RE + Sbjct: 1652 ERKSERSSQRSQRSLREGERYYEERREES 1680 >SB_2460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 555 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/68 (23%), Positives = 30/68 (44%) Frame = +2 Query: 101 SPKERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARR 280 S K T++R + S ++ G +ERS +E A+P + E +E+ + Sbjct: 464 SNKSSSNGTQMRSNSGSLSQNWRKQEGRKERSGSDETEAKPSEVAAEETVAEEKVNSEEK 523 Query: 281 R*IQSEHQ 304 ++S Q Sbjct: 524 SSVESAEQ 531 >SB_54706| Best HMM Match : Linker_histone (HMM E-Value=0.014) Length = 323 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 131 LRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPER 244 L++RN S QR R RN+P+ RPP S P + Sbjct: 80 LKERNGSSLKSLQR-----NRQLRNQPQRRPPNSQPRK 112 >SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1560 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 110 ERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPE 241 E H R R + QQR+ L+ R Q ++ + RP P+ Sbjct: 994 EEHVTELNRQREEKDTSHQQRVKELERRKQHHQSQLRPTLGHPQ 1037 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 110 ERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPE 241 E H R R + QQR+ L+ R Q ++ + RP P+ Sbjct: 1130 EEHVTELNRQREEKDTSHQQRVKELERRKQHHQSQLRPTLGHPQ 1173 >SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 28.3 bits (60), Expect = 3.1 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +2 Query: 107 KERHRPTKL-RDRNPSERHEQQRLSGLQER-SQRNEPRARPPQSGPERECVQERG 265 K +H +L R+R ER E++ L LQ R + +E AR ERE +E G Sbjct: 740 KRKHEEARLQREREARER-EERELRELQRREEEEHESLAREEGERAERESQREAG 793 >SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 583 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/64 (20%), Positives = 27/64 (42%) Frame = +2 Query: 128 KLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQ 307 +L + P E + S + ++ RP + +E QE+ +R + H++ Sbjct: 425 RLEEERPEEERTHEERSHKERSQEKRSHEKRPHEERSHKERSQEKRSHEKRPHEERSHEE 484 Query: 308 RSRQ 319 RS + Sbjct: 485 RSEE 488 >SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) Length = 772 Score = 27.9 bits (59), Expect = 4.0 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = +3 Query: 162 SNNG*VGYRSDHSGMSQGRDHRRVGQNGSVYKSGVLAHDGVESRVSISSVVDSALS 329 S N +G+ S QG DH G+NG + + G LA+ G+ S SI ++ L+ Sbjct: 456 SFNSALGHLSSSKINLQGNDHANYGENG-INELGQLANTGL-SDSSIQRLIGQLLA 509 >SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 4.0 Identities = 22/65 (33%), Positives = 25/65 (38%), Gaps = 4/65 (6%) Frame = -3 Query: 291 WIQRRRAQGPRSCTHSRSGPLCGGRALGSF--RCD-RSCSPLSR-CCSWRSLGLRSRSFV 124 W +R QG S G GGR G F CD RS +R C G R Sbjct: 82 WRERDHGQGGSRRNESSHGGYRGGRNQGGFGGSCDERSYRDGTRVSCDDGGFGSRGNKGA 141 Query: 123 GLWRS 109 G W+S Sbjct: 142 GRWKS 146 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 27.9 bits (59), Expect = 4.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = -1 Query: 443 TSFSYGVSDPHTGDVKSQHETRVGDSVVGQYSLLES 336 TS + +SD H+G + + + ++GDS + + S + S Sbjct: 2740 TSIAEELSDRHSGSSEVEEDIKIGDSSISEASEIRS 2775 >SB_21618| Best HMM Match : Yip1 (HMM E-Value=1.1) Length = 338 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -3 Query: 204 FRCDRSCSP-LSR-CCSWRSLGLRSR 133 F CDR+C+P SR CC + L RSR Sbjct: 268 FACDRACAPTCSRACCRSQYLAARSR 293 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Frame = +2 Query: 104 PKERHRP-----TKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERE 247 P+ R RP + RD P R + R G +ER PR+ QS + E Sbjct: 615 PRSRERPRSRERSDRRDERPQRRGSRGRSPGRREREGERRPRSAERQSRRQDE 667 >SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3474 Score = 27.5 bits (58), Expect = 5.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -1 Query: 443 TSFSYGVSDPHTGDVKSQHETRVGDSVVGQYSLLESDGTKRTVDYA 306 T + G + T D S ++ GDSV +Y+ L D T++ DYA Sbjct: 1276 TKVTRGNNASVTLDASSSYDPDTGDSVGLRYTWLCRDRTEKLPDYA 1321 >SB_50629| Best HMM Match : Extensin_2 (HMM E-Value=0.94) Length = 450 Score = 27.5 bits (58), Expect = 5.3 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +2 Query: 101 SPKERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARR 280 SP++R + +P +R R + R + N PR R P S +R + R P + R Sbjct: 276 SPRQRSNSPRRVPVSPRQRSNSPRRVPVSPRQRSNSPR-RVPVSPRQRPNLPRRVPLSSR 334 Query: 281 R 283 + Sbjct: 335 Q 335 >SB_34735| Best HMM Match : NUDIX (HMM E-Value=6.1) Length = 431 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 219 RALGSFRCDRSCSPLSRCCS 160 R L SFRC +S S CCS Sbjct: 310 RCLNSFRCKQSLEKHSECCS 329 >SB_31651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 113 APLGYAHGAIATPLAHAGPLAYSAPLAHDVAYGAHGI 3 AP G A+A + H AY A +AHD +YG +G+ Sbjct: 177 APDGEQSKAMADIIEHF-KWAYVAAIAHDGSYGQYGV 212 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 27.5 bits (58), Expect = 5.3 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHE--QQRLSGLQERSQRNEPRARPPQSGPERE 247 +ER R + DR P +RHE ++G SQ + R R GP+RE Sbjct: 522 REREREGRHMDRGPRDRHEGDYTEVTGGSRWSQGDRDRDR----GPDRE 566 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 27.5 bits (58), Expect = 5.3 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = +2 Query: 134 RDRNPSERHEQQRLSGLQ---ERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQ 304 RDRN + ++++R + E+ +R++ R + + ERE +ER R +S H+ Sbjct: 613 RDRNREKENDREREKEREKEKEKEERDKEREKEKEKEKEREKEKEREREKERDRDKSSHK 672 Query: 305 QR 310 +R Sbjct: 673 KR 674 >SB_6936| Best HMM Match : TP2 (HMM E-Value=1.1) Length = 256 Score = 27.5 bits (58), Expect = 5.3 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = +2 Query: 137 DRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQRSR 316 DR H + R ++R + + P P+R+ +ER AR R + RSR Sbjct: 155 DRQRPSPHRRSRPRNRKDRQLDKKTKTLPNSYAPKRDKPRERKKVARDRSRSPRSRSRSR 214 Query: 317 Q 319 + Sbjct: 215 E 215 >SB_1355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 219 RALGSFRCDRSCSPLSRCCS 160 R L SFRC +S S CCS Sbjct: 183 RCLNSFRCKQSLEKHSECCS 202 >SB_52016| Best HMM Match : Cystatin (HMM E-Value=0.87) Length = 212 Score = 27.5 bits (58), Expect = 5.3 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +2 Query: 137 DRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQRSR 316 +RN + RH +LS Q+R +R+ R PP P R +RG R SE S+ Sbjct: 139 ERNHT-RHVSYQLSNYQQRVRRSSDREAPP---PPRRRSSDRGMTTPTRRRSSEKGPASQ 194 Query: 317 Q 319 + Sbjct: 195 K 195 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -3 Query: 264 PRSCTHSRSGPLCGGRALG--SFRCDRSCSPLSRCCSWRSLGLRSRSFVG 121 P C H + GP C +++G F C P C + +G +SF G Sbjct: 898 PFPCPHYQGGPACECKSMGYTPFACPH--YPGGPACKCQCMGQHQQSFQG 945 >SB_22132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/62 (24%), Positives = 34/62 (54%) Frame = +2 Query: 134 RDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQRS 313 + + P + +QQ+ L+++ Q+ +PR + Q P + Q++ P +++ Q QQ+ Sbjct: 69 QQQQPRLQQQQQQQPRLKQQQQQ-QPRLKQQQQQPRLKQQQQQQPRLKQQQQQPRLQQQQ 127 Query: 314 RQ 319 +Q Sbjct: 128 QQ 129 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +2 Query: 161 EQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQRSR 316 +QQR L+ Q +E R P E V + R+R + +HQ+ S+ Sbjct: 324 QQQRRRELEREEQGSEQRELDTSGSPAHELVHKLSSKKRKR-VSGDHQKPSK 374 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 27.1 bits (57), Expect = 7.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 445 TPASXTACQTPTPATSRASTRPASVTA 365 TP+ T+ +P A+ ++STRP TA Sbjct: 189 TPSGSTSPTSPNNASPQSSTRPGETTA 215 >SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) Length = 1044 Score = 27.1 bits (57), Expect = 7.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 258 SCTHSRSGPLCGGRALGSFRCDRSCS 181 +C+HS G LCG + G +R C+ Sbjct: 293 TCSHSYEGVLCGACSRGYYRMFSGCN 318 >SB_48266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 27.1 bits (57), Expect = 7.1 Identities = 24/91 (26%), Positives = 41/91 (45%) Frame = +3 Query: 87 GSVSVAQRSAIGQRSSVTVTQVSAMSNNG*VGYRSDHSGMSQGRDHRRVGQNGSVYKSGV 266 GS+S SAI ++ S++ SA+S G + R + +G R + + + + Sbjct: 513 GSISSRLCSAISRQGSISSRLCSAISRQGSISSRLSSAISRRGSMSSRSSSDVGI-QGSI 571 Query: 267 LAHDGVESRVSISSVVDSALSTVRFQERVLS 359 L+ E +V S+ S S V QE + S Sbjct: 572 LSRPNSEFKVQ-GSISSSPSSDVGGQEPISS 601 >SB_12095| Best HMM Match : Vicilin_N (HMM E-Value=0.083) Length = 501 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = +2 Query: 113 RHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCAR 277 R R L++ + E+Q + +QER++++ RAR + +R+ ++E C R Sbjct: 302 RRRLKALQEAEQALEEERQCRTKMQERAEQSVERAREEMTDWKRQ-IEELSGCCR 355 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +2 Query: 101 SPKERHRPTKLRDRNPSERHEQQRL-SGLQERSQRNEPRARPPQSGPERECVQER 262 SP R ++ R R+P RH + R + + RS+ + P + + ++E ++R Sbjct: 250 SPHHRSHRSRSRSRSPRRRHSRSRSPTHRRHRSRSHSPEKKKHKKKEKKEKDEKR 304 >SB_645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 684 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +2 Query: 173 LSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQRSRQ 319 +S Q+RS+ + P R P R + R P RR +S RQ Sbjct: 122 ISYFQQRSKSSSPSRRARSRSPGRRRSRSRSPARRRTAARSSPSPPKRQ 170 >SB_35402| Best HMM Match : Collagen (HMM E-Value=0.39) Length = 657 Score = 27.1 bits (57), Expect = 7.1 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +3 Query: 93 VSVAQRSAIGQRSSV---TVTQVSAMSNNG*VGYRSDHSGMSQGRDHRRVGQNGSVYKSG 263 ++ AQ ++ GQ ++ QVS M+ G G + M QG ++GQ G + + G Sbjct: 182 IATAQVNSGGQSATALGSNSAQVSNMAKGGLAGQGGQMNQMRQGGQMNQMGQGGQMNQMG 241 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGP 268 + R +R R R E+ R+ +ER ++ E + R + +RE E GP Sbjct: 1210 RRRDEDEAIRRREEMRRREEDRIREEEERRKQEELKLRLQEEARQRERTDE-GP 1262 >SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.1 bits (57), Expect = 7.1 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQER 262 K+R K RD++ + S +R +R+E R + P+S ERE ++R Sbjct: 231 KKREEEKKDRDKDKDREDRKSSSSRESKRERRSEEREKRPRS-RERERSRDR 281 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +2 Query: 107 KERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQER 262 K+R + DR S E +R +ER +R R R ER +ER Sbjct: 238 KDRDKDKDREDRKSSSSRESKRERRSEEREKRPRSRERERSRDRERSRDRER 289 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 27.1 bits (57), Expect = 7.1 Identities = 21/73 (28%), Positives = 29/73 (39%) Frame = +2 Query: 101 SPKERHRPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARR 280 SP+ R R D +P R E R + R A PP+ R+ + P RR Sbjct: 832 SPRRRRRSASGSDSSPHRRSESPRDRRRRSPEHRRRREASPPR----RDRKRYDSPPRRR 887 Query: 281 R*IQSEHQQRSRQ 319 R S +R R+ Sbjct: 888 RRSPSPPPRRRRR 900 >SB_9492| Best HMM Match : Rho_N (HMM E-Value=2.1e-12) Length = 1970 Score = 27.1 bits (57), Expect = 7.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 219 RALGSFRCDRSCSPLSRCC 163 R L SFRC++S S CC Sbjct: 564 RCLNSFRCEQSLEKHSECC 582 >SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2671 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 110 PLGYAHGAIATPLAHAGPLAYSAPLAHDVAYGAHGI 3 P G A+A + H +Y A +AHD +YG HG+ Sbjct: 182 PDGEQSKAMADIIDHFN-WSYVAAVAHDGSYGQHGV 216 >SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 3/82 (3%) Frame = +2 Query: 119 RPTKLRDRNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQ-- 292 RPT+ + ++ +QQ+ Q+ +Q N+ + + Q + Q++ P ++ Q Sbjct: 507 RPTQAPNSGQQQQQQQQQQENNQQYNQGNQQQQQDSQQNRQPGGQQQQQPEQQQTNSQLQ 566 Query: 293 -SEHQQRSRQCA*YRQIPREST 355 ++ Q Q Y Q P S+ Sbjct: 567 SQQYNQNQEQAPLYSQYPTLSS 588 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 128 KLRDRNPSERHEQQRLSGLQERSQRNE 208 +L + + SE +E+QR LQE+ +RN+ Sbjct: 1626 RLEEASRSEEYERQRQLELQEKERRNK 1652 >SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/60 (20%), Positives = 32/60 (53%) Frame = +2 Query: 140 RNPSERHEQQRLSGLQERSQRNEPRARPPQSGPERECVQERGPCARRR*IQSEHQQRSRQ 319 + ++ +QQ+ Q++ Q+ + + PQ +++ QE+ +++ Q + QQ+ +Q Sbjct: 16 KQQQQQQQQQQQQQQQQQQQQQQQQQPQPQQQQQQQQEQEQQQQQQQQQQQQQQQQQQQQ 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,087,340 Number of Sequences: 59808 Number of extensions: 203475 Number of successful extensions: 1175 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -