Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_pT_H05
         (670 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase prot...    22   6.1  
DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    21   8.0  

>AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase
           protein.
          Length = 693

 Score = 21.8 bits (44), Expect = 6.1
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 365 YWHRIYNLEGD 333
           +WH +Y  EGD
Sbjct: 211 HWHLVYPFEGD 221


>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%)
 Frame = +1

Query: 181 AFFWSLANL--FSYLETFFSVGLTNLPLRSLTWEFRSE 288
           +F + +A L  F+ +  F  VG   +PL    WE  +E
Sbjct: 314 SFGYCIATLLEFAGVHYFTKVGSGEIPLEEEEWENENE 351


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,352
Number of Sequences: 438
Number of extensions: 1951
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20221290
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)