BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_H04 (714 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66521-18|CAO82066.1| 134|Caenorhabditis elegans Hypothetical p... 101 4e-22 Z66521-17|CAI46628.1| 103|Caenorhabditis elegans Hypothetical p... 101 4e-22 AB031233-1|BAA92262.1| 605|Caenorhabditis elegans kinesin like ... 101 4e-22 Z34802-9|CAB54281.3| 160|Caenorhabditis elegans Hypothetical pr... 34 0.088 U80839-8|AAB37914.1| 238|Caenorhabditis elegans Hypothetical pr... 31 1.1 U41534-1|AAB47593.3| 1437|Caenorhabditis elegans Temporarily ass... 31 1.1 Z93397-5|CAD89745.1| 375|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z70781-3|CAA94833.2| 352|Caenorhabditis elegans Hypothetical pr... 28 5.8 Z81595-8|CAB54305.1| 345|Caenorhabditis elegans Hypothetical pr... 28 7.6 Z81595-7|CAB54304.1| 358|Caenorhabditis elegans Hypothetical pr... 28 7.6 Z72503-4|CAA96595.1| 354|Caenorhabditis elegans Hypothetical pr... 28 7.6 M38251-1|AAA28059.1| 354|Caenorhabditis elegans G-o protein alp... 28 7.6 AY008140-1|AAG32093.1| 354|Caenorhabditis elegans heterotrimeri... 28 7.6 >Z66521-18|CAO82066.1| 134|Caenorhabditis elegans Hypothetical protein W02B12.15b protein. Length = 134 Score = 101 bits (243), Expect = 4e-22 Identities = 40/63 (63%), Positives = 50/63 (79%) Frame = -3 Query: 529 SGQINPCIRKDINKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPV 350 S + N I+ D NK+VD +DIEDI EK + CRCW+S+ WPYCDGSHG HNKETGDN GP+ Sbjct: 68 SARCNYKIQLDSNKIVDTVDIEDIGEKKAFCRCWKSEKWPYCDGSHGKHNKETGDNVGPL 127 Query: 349 VVR 341 +V+ Sbjct: 128 IVK 130 >Z66521-17|CAI46628.1| 103|Caenorhabditis elegans Hypothetical protein W02B12.15a protein. Length = 103 Score = 101 bits (243), Expect = 4e-22 Identities = 40/63 (63%), Positives = 50/63 (79%) Frame = -3 Query: 529 SGQINPCIRKDINKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPV 350 S + N I+ D NK+VD +DIEDI EK + CRCW+S+ WPYCDGSHG HNKETGDN GP+ Sbjct: 37 SARCNYKIQLDSNKIVDTVDIEDIGEKKAFCRCWKSEKWPYCDGSHGKHNKETGDNVGPL 96 Query: 349 VVR 341 +V+ Sbjct: 97 IVK 99 >AB031233-1|BAA92262.1| 605|Caenorhabditis elegans kinesin like protein protein. Length = 605 Score = 101 bits (243), Expect = 4e-22 Identities = 40/63 (63%), Positives = 50/63 (79%) Frame = -3 Query: 529 SGQINPCIRKDINKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPV 350 S + N I+ D NK+VD +DIEDI EK + CRCW+S+ WPYCDGSHG HNKETGDN GP+ Sbjct: 68 SARCNYKIQLDSNKIVDTVDIEDIGEKKAFCRCWKSEKWPYCDGSHGKHNKETGDNVGPL 127 Query: 349 VVR 341 +V+ Sbjct: 128 IVK 130 >Z34802-9|CAB54281.3| 160|Caenorhabditis elegans Hypothetical protein M88.7 protein. Length = 160 Score = 34.3 bits (75), Expect = 0.088 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = -3 Query: 490 KVVDFIDIEDITEKASLCRCWRSKNWPYCDGSH 392 K V FI +D+T LC C ++ N P+CDGSH Sbjct: 116 KPVRFIPDKDMT--VWLCNCKQTNNRPFCDGSH 146 >U80839-8|AAB37914.1| 238|Caenorhabditis elegans Hypothetical protein ZC204.10 protein. Length = 238 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -1 Query: 225 LRKCLKRNALYNIISVLFISYKT 157 LRKCLKR ++ +IS+ F+S KT Sbjct: 16 LRKCLKRMSVAQLISISFLSKKT 38 >U41534-1|AAB47593.3| 1437|Caenorhabditis elegans Temporarily assigned gene nameprotein 213 protein. Length = 1437 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 449 LLSYILN-VNKVHNFINVLPDTRVYLTTASFSGFFYCLV 562 +LSY+L+ V NFI + D+ YLT+ F YC++ Sbjct: 560 VLSYLLSQVQTFDNFIGPVVDSLRYLTSLEFDVLTYCII 598 >Z93397-5|CAD89745.1| 375|Caenorhabditis elegans Hypothetical protein ZC482.8 protein. Length = 375 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 467 NVNKVHNFINVLPD-TRVYLTTASFSGFFYCLVRVVRYT 580 N++K + VL D T+ ASFSGFF LV +V T Sbjct: 32 NLHKHFELVTVLTDVTKQLYDIASFSGFFLNLVHLVILT 70 >Z70781-3|CAA94833.2| 352|Caenorhabditis elegans Hypothetical protein F57A8.5 protein. Length = 352 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 690 PFPTICRACRFQILLADGFVLEL 622 P+P C++CRFQ L G LE+ Sbjct: 65 PYPLKCQSCRFQRCLDAGMYLEV 87 >Z81595-8|CAB54305.1| 345|Caenorhabditis elegans Hypothetical protein T22H2.6b protein. Length = 345 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 322 IQINSKCSFQKNYVKTNYCIVLFKIKHF 239 I NSK +KN V+ +CI+ F IK+F Sbjct: 6 INQNSKHITKKNDVRIFFCILYFNIKYF 33 >Z81595-7|CAB54304.1| 358|Caenorhabditis elegans Hypothetical protein T22H2.6a protein. Length = 358 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 322 IQINSKCSFQKNYVKTNYCIVLFKIKHF 239 I NSK +KN V+ +CI+ F IK+F Sbjct: 6 INQNSKHITKKNDVRIFFCILYFNIKYF 33 >Z72503-4|CAA96595.1| 354|Caenorhabditis elegans Hypothetical protein C26C6.2 protein. Length = 354 Score = 27.9 bits (59), Expect = 7.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 75 HESLRLMKKTCNNRW 31 HESL+L CNN+W Sbjct: 245 HESLKLFDSICNNKW 259 >M38251-1|AAA28059.1| 354|Caenorhabditis elegans G-o protein alpha subunit protein. Length = 354 Score = 27.9 bits (59), Expect = 7.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 75 HESLRLMKKTCNNRW 31 HESL+L CNN+W Sbjct: 245 HESLKLFDSICNNKW 259 >AY008140-1|AAG32093.1| 354|Caenorhabditis elegans heterotrimeric G protein alphasubunit protein. Length = 354 Score = 27.9 bits (59), Expect = 7.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 75 HESLRLMKKTCNNRW 31 HESL+L CNN+W Sbjct: 245 HESLKLFDSICNNKW 259 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,866,087 Number of Sequences: 27780 Number of extensions: 304852 Number of successful extensions: 815 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1666201324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -