BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G21 (572 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 26 1.0 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 26 1.0 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 23 5.3 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 23 5.3 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 23 5.3 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 23 5.3 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 23 7.1 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.3 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.3 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 25.8 bits (54), Expect = 1.0 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 158 HELVEVNSAASVSVDLLDEAIEFIVSQLLVQFPEDLAQA 274 H + E+ +AA+VSV+++ EAI +L Q + QA Sbjct: 274 HTVEELAAAANVSVEVIKEAIRVRQQELRAQKQYEKQQA 312 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +2 Query: 158 HELVEVNSAASVSVDLLDEAIEFIVSQLLVQFPEDLAQA 274 H + E+ +AA+VSV+++ EAI V Q ++ PE + +A Sbjct: 281 HTVEELAAAANVSVEVIKEAIR--VRQQELRGPEAVREA 317 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 406 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 269 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGVTPTSSI 100 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 406 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 269 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGVTPTSSI 100 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 406 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 269 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGVTPTSSI 100 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 406 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 269 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGVTPTSSI 100 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.0 bits (47), Expect = 7.1 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 406 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 269 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGATPTSSI 100 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +2 Query: 374 SGQSYELGEFQTTRFVGVDFLNKLLEDFLVEWLPHHSQDISHEV 505 S Q++ + + T F+G DFL + L ++ +H + +S ++ Sbjct: 334 SPQTHRMAPWVKTFFIGKDFLPRFLFMKRPPYIENHRKLLSKDL 377 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +2 Query: 374 SGQSYELGEFQTTRFVGVDFLNKLLEDFLVEWLPHHSQDISHEV 505 S Q++ + + T F+G DFL + L ++ +H + +S ++ Sbjct: 334 SPQTHRMAPWVKTFFIGKDFLPRFLFMKRPPYIENHRKLLSKDL 377 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,528 Number of Sequences: 2352 Number of extensions: 7267 Number of successful extensions: 21 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -