BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G19 (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 26 0.37 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 26 0.37 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 25 0.48 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 7.9 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 7.9 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 25.8 bits (54), Expect = 0.37 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 33 IHKKFIAQSFFQXKKL--ISAFCLRPSGAIKIK 125 I KKFI ++ K + +S LRP G+IK+K Sbjct: 452 ILKKFILEAVDTRKDMAFVSDLVLRPKGSIKVK 484 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 25.8 bits (54), Expect = 0.37 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 33 IHKKFIAQSFFQXKKL--ISAFCLRPSGAIKIK 125 I KKFI ++ K + +S LRP G+IK+K Sbjct: 452 ILKKFILEAVDTRKDMAFVSDLVLRPKGSIKVK 484 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 25.4 bits (53), Expect = 0.48 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Frame = +3 Query: 177 SQW---WSFSPLRSKQRAYSRGMRAP 245 SQW W+F+P+R + + G+R P Sbjct: 254 SQWLAHWAFAPIRWVAKLWDSGLRKP 279 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 712 NRQRXHDVPEGAVPV 668 N+Q ++P GA+PV Sbjct: 233 NKQHNFNLPPGAIPV 247 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 316 SFMHYGRHEYILLCD 360 S++ GR+E ILLC+ Sbjct: 251 SYVDGGRNEIILLCE 265 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,462 Number of Sequences: 336 Number of extensions: 3097 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -