BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G18 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 1.8 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 7.4 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 329 PGTDPVDRMVNSRRRPK-HVITDPPD 403 PG P+D V+SR+R ++ PP+ Sbjct: 237 PGNGPLDLSVSSRKRSNDDSVSQPPN 262 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 7.4 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 307 GTWIFMMTWNRSCRPNGKQSTSPKTRHYGSSRS 405 GT TW S R Q T RH S+ S Sbjct: 265 GTQFISNTWQNSLRAADIQPTLSSIRHPESNPS 297 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,256 Number of Sequences: 336 Number of extensions: 3307 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -