BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G18 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 29 2.3 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 29 2.3 At1g16900.1 68414.m02047 curculin-like (mannose-binding) lectin ... 29 2.3 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +1 Query: 367 TSPKTRHYGSSRSINGVFRYHKHRSPS--SSNPSLATKGSTSELTHRHSPLSF 519 TSP+T HY S + + +Y H PS SS+P + + ++ ++ P S+ Sbjct: 53 TSPQTPHYNSPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSY 105 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +1 Query: 367 TSPKTRHYGSSRSINGVFRYHKHRSPS--SSNPSLATKGSTSELTHRHSPLSF 519 TSP+T HY S + + +Y H PS SS+P + + ++ ++ P S+ Sbjct: 35 TSPQTPHYNSPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSY 87 >At1g16900.1 68414.m02047 curculin-like (mannose-binding) lectin family protein very low similarity to Ser Thr protein kinase GI:2598067 from (Zea mays); contains Pfam lectin (probable mannose binding) domain PF01453 Length = 919 Score = 29.5 bits (63), Expect = 2.3 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +1 Query: 322 MMTWNRSCRPNGKQSTSPKTRHY 390 +M W+++C+P +S PK+ HY Sbjct: 303 LMGWSKACKPKKVKSCDPKSFHY 325 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,166,451 Number of Sequences: 28952 Number of extensions: 301057 Number of successful extensions: 764 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -