BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G15 (862 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 24 1.6 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 23 3.6 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 78 LNVALLKLAAYFHYLKIITILRGKIVVLWPFAFVVNIYS 194 L+ L K A K + I+ G ++ W FVVN++S Sbjct: 320 LSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLWS 358 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 23.0 bits (47), Expect = 3.6 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +1 Query: 637 QPQLVFGF----GY*RPYLLHQDLYGMLVANWLC 726 + Q FGF GY P +L ++ YG V W C Sbjct: 65 EAQAWFGFAGTPGYLSPEVLKKEPYGKPVDIWAC 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 227,049 Number of Sequences: 438 Number of extensions: 4856 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -