BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G11 (513 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26H5.06 |pot1||telomere end-binding protein Pot1 |Schizosacc... 25 5.0 SPAC323.07c |||MatE family transporter|Schizosaccharomyces pombe... 25 6.7 >SPAC26H5.06 |pot1||telomere end-binding protein Pot1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 555 Score = 25.4 bits (53), Expect = 5.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 395 VRTXYSKRRRWCCCVTCYLKNEILDVMLPYTPS 297 ++T YS + + VT Y +NE+ M PYT S Sbjct: 220 IKTWYSDKN-FTLYVTDYTENELFFPMSPYTSS 251 >SPAC323.07c |||MatE family transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.0 bits (52), Expect = 6.7 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 220 TKILYFLILLVKLDVTYNYCVRWRPSDG 303 T I Y L L++ NY + W P+ G Sbjct: 241 TPITYVLCFAAPLNILLNYLLVWHPTIG 268 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,815,106 Number of Sequences: 5004 Number of extensions: 30943 Number of successful extensions: 50 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 206265012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -