BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G11 (513 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0611 + 24347384-24350015,24350126-24350497,24350561-243508... 29 2.2 01_06_0410 + 29146016-29146428,29146504-29146861,29147454-291474... 28 5.1 >02_04_0611 + 24347384-24350015,24350126-24350497,24350561-24350805, 24350997-24351059,24351919-24352422 Length = 1271 Score = 29.1 bits (62), Expect = 2.2 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +1 Query: 229 LYFLILLVKLDVTYNYCVRWRPSDGVYGNITS 324 L +L LL KLD++YN P+ GV+ N+TS Sbjct: 562 LGYLPLLSKLDLSYNNLQGEVPTVGVFRNVTS 593 >01_06_0410 + 29146016-29146428,29146504-29146861,29147454-29147495, 29148491-29148721 Length = 347 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +3 Query: 435 LXLCQYIP---YTLCYNMTSTSIGR 500 L LC ++P Y L YNM S S+GR Sbjct: 203 LLLCCFVPAVGYALGYNMNSASVGR 227 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,531,951 Number of Sequences: 37544 Number of extensions: 162684 Number of successful extensions: 287 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -