BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G11 (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_12975| Best HMM Match : Zona_pellucida (HMM E-Value=6.6e-12) 28 5.2 >SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2103 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = +1 Query: 115 YSLIVRFYTLINII*HCKXIDNIQLYRNKFITYSRTKILYFLILLVKLDVTYNY 276 +++I+ FY +++ D LY F+ YS + YFL L ++ N+ Sbjct: 70 FTIILIFYAVLSFTAMFAFGDLKDLYTLNFVIYSNAYVRYFLALFPVFTLSTNF 123 >SB_12975| Best HMM Match : Zona_pellucida (HMM E-Value=6.6e-12) Length = 515 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +1 Query: 256 LDVTYNYCVRWRPSDGVYGNITSKISFFK 342 + +Y++ R+ S+G YGN T K+S ++ Sbjct: 252 VSTSYSHVGRYMASEGGYGNFTFKMSLYR 280 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,061,241 Number of Sequences: 59808 Number of extensions: 214456 Number of successful extensions: 322 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 322 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -