BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G11 (513 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U46024-1|AAC51682.1| 603|Homo sapiens myotubularin protein. 31 2.4 BC030779-1|AAH30779.1| 603|Homo sapiens myotubularin 1 protein. 31 2.4 AF020676-1|AAC12865.1| 603|Homo sapiens myotubularin protein. 31 2.4 >U46024-1|AAC51682.1| 603|Homo sapiens myotubularin protein. Length = 603 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 178 NIQLYRNKFITYSRTKILYFLILLVKLDVTYNYCVRWRP 294 N + ++N F T ++LY + + L++ NY +RW P Sbjct: 505 NKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNP 543 >BC030779-1|AAH30779.1| 603|Homo sapiens myotubularin 1 protein. Length = 603 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 178 NIQLYRNKFITYSRTKILYFLILLVKLDVTYNYCVRWRP 294 N + ++N F T ++LY + + L++ NY +RW P Sbjct: 505 NKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNP 543 >AF020676-1|AAC12865.1| 603|Homo sapiens myotubularin protein. Length = 603 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 178 NIQLYRNKFITYSRTKILYFLILLVKLDVTYNYCVRWRP 294 N + ++N F T ++LY + + L++ NY +RW P Sbjct: 505 NKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNP 543 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,887,052 Number of Sequences: 237096 Number of extensions: 983427 Number of successful extensions: 5514 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5514 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4820001670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -