BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G10 (760 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 25 1.9 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 25 2.5 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 25.4 bits (53), Expect = 1.9 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 638 KGPNKHTLTQIKDAVRDGLRAINNAIEDKCVIPGAAAFEIKANTELLK-YKDTVK 477 KGP H I + + G+ A+ N D A +KAN K DTVK Sbjct: 72 KGPRGHPGECIAECIMKGMGALKNEKVDGPAFRKAIEPVVKANPAFAKLLDDTVK 126 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 25.0 bits (52), Expect = 2.5 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 8/81 (9%) Frame = -3 Query: 707 VLGEDKFTFVEQCKNPQSVTILIKGPNKHTLTQIKDAVRDGLRAINNAIEDKCVIP---- 540 +LG K T ++ + +S+ L+ + H + D + L AI++ +ED V+P Sbjct: 286 LLGPQK-TDLDYHEVGRSIATLMSNEHFHDIAYTADDREELLSAIDDFLEDSIVLPPSKW 344 Query: 539 ---GAAAF-EIKANTELLKYK 489 G F E+KA +++++ + Sbjct: 345 ERQGLLPFEELKARSDMIRLR 365 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 716,141 Number of Sequences: 2352 Number of extensions: 14088 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -