BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_G10 (760 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 24 1.3 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.4 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 7.2 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 24.2 bits (50), Expect = 1.3 Identities = 18/84 (21%), Positives = 38/84 (45%), Gaps = 4/84 (4%) Frame = +1 Query: 472 LPLTVSLYFSSSVLALISKAAAPGMTHLSSMALLIARRPSRTASLIC--VKVCLLGPLMR 645 L ++ S + + AL+SK + M H+ + L A ++C V ++G L Sbjct: 246 LSISASCVIAFATSALVSKDSKFNMVHIQNSTLAGGVAIGTAAGMMCQPVGTLIVGALAG 305 Query: 646 MVTDCGFLHCSTKV--NLSSPSTC 711 +++ G+ + + + +L TC Sbjct: 306 LLSVLGYKYITPLIQKHLKIHDTC 329 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 429 YS*NSGR*LWLRCSRYYSK 373 +S N+G +WL CS ++ + Sbjct: 407 WSVNAGMWMWLSCSSFFQQ 425 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 405 VNGQSFRNNQKSFGISLDSKTSLAFNSVL 491 +NG+SF FG++L T + S L Sbjct: 240 INGESFTLQSGIFGMALSPLTQNLYYSAL 268 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,891 Number of Sequences: 438 Number of extensions: 4091 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -