BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F20 (577 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 132 3e-32 SPBC29A3.10c |atp14||F1-ATPase subunit H |Schizosaccharomyces po... 25 6.0 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 132 bits (320), Expect = 3e-32 Identities = 71/166 (42%), Positives = 93/166 (56%), Gaps = 2/166 (1%) Frame = -3 Query: 548 LXTAYQ**RDISREGTYQGKHTILVNKGLR*GXXXXXXXXXXXXXXXXXXXFHRRLSPNI 369 L T Y RD+S E G HT V KGL+ G FH LSP Sbjct: 61 LATMYLWFRDMSTEANIHGAHTKAVTKGLKIGFMLFLISETFLFASIFWAFFHSSLSPTF 120 Query: 368 EIGRI*PPSRITP--FNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRLFLTIL 195 E+G + PP I +P ++PLLNT+IL+ SG ++T AH+SLI N + L++TI Sbjct: 121 ELGAVWPPVGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARNRENALKGLYMTIA 180 Query: 194 LGFYFTILQAYEYIEASFTIADRIYGSTFFIATGFHGXHVIIGTXL 57 L F F QAYEY A FTI+D +YG++F+ ATG HG H+I+GT L Sbjct: 181 LSFLFLGGQAYEYWNAPFTISDSVYGASFYFATGLHGIHIIVGTIL 226 >SPBC29A3.10c |atp14||F1-ATPase subunit H |Schizosaccharomyces pombe|chr 2|||Manual Length = 103 Score = 25.4 bits (53), Expect = 6.0 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -3 Query: 245 IENNFSQTKQRLFLTILLGFYFTILQAYE 159 + ++S T RL++ ++ G Y + L++Y+ Sbjct: 8 LSRSYSTTSPRLYVDVVQGLYISSLKSYK 36 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,806,098 Number of Sequences: 5004 Number of extensions: 29111 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -