BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F20 (577 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 140 5e-34 At5g19130.2 68418.m02277 GPI transamidase component family prote... 29 2.9 At5g19130.1 68418.m02276 GPI transamidase component family prote... 29 2.9 At2g06090.1 68415.m00668 self-incompatibility protein-related si... 27 6.8 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 140 bits (340), Expect = 5e-34 Identities = 74/164 (45%), Positives = 91/164 (55%) Frame = -3 Query: 524 RDISREGTYQGKHTILVNKGLR*GXXXXXXXXXXXXXXXXXXXFHRRLSPNIEIGRI*PP 345 RD+ RE T +G HT +V G R G H L+P +EIG I PP Sbjct: 62 RDVLRESTLEGHHTKVVQLGPRYGSILFIVSEVMFFFAFFWASSHSSLAPAVEIGGIWPP 121 Query: 344 SRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRLFLTILLGFYFTILQA 165 I +P++IP LNT IL SG VT AHH+++ + L T+LL FT Q Sbjct: 122 KGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVATVLLALVFTGFQG 181 Query: 164 YEYIEASFTIADRIYGSTFFIATGFHGXHVIIGTXLRXICEMRQ 33 EY +A FTI+D IYGSTFF+ATGFHG HVIIGT IC +RQ Sbjct: 182 MEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQ 225 >At5g19130.2 68418.m02277 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 696 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 173 LQAYEYIEASFTIADRIYGSTFFIATGFHG 84 + A +Y+E S T+A +Y I TG HG Sbjct: 352 IPAADYLEGSATLASSLYSQALGIPTGPHG 381 >At5g19130.1 68418.m02276 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 699 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 173 LQAYEYIEASFTIADRIYGSTFFIATGFHG 84 + A +Y+E S T+A +Y I TG HG Sbjct: 355 IPAADYLEGSATLASSLYSQALGIPTGPHG 384 >At2g06090.1 68415.m00668 self-incompatibility protein-related similar to S1 self-incompatibility protein [Papaver rhoeas] GI:452430 Length = 135 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 194 LGFYFTILQAYEYIEASFTIADRIYGSTFFIATGFHG 84 LG + T+ ++YEY +F D ++G T F T HG Sbjct: 53 LGIH-TVARSYEY---NFKFEDSVFGRTEFFCTLMHG 85 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,935,283 Number of Sequences: 28952 Number of extensions: 138503 Number of successful extensions: 194 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1121903184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -