BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F19 (771 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.0 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.0 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 23 2.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.6 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 6.2 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 6.2 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 452 FFVP*SQSFWASVQSSIWKLLAWVWQFWLL 541 FFVP F +Q + AW+W WLL Sbjct: 200 FFVPPPLMF---LQDFLSHQHAWIWLVWLL 226 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 452 FFVP*SQSFWASVQSSIWKLLAWVWQFWLL 541 FFVP F +Q + AW+W WLL Sbjct: 433 FFVPPPLMF---LQDFLSHQHAWIWLVWLL 459 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 278 WMPTTSLNSLSRLKQQ*RRLKITTPWSLL 192 WMP+T N L L +KI S+L Sbjct: 853 WMPSTMANILDLLMDYEHTVKINENISML 881 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 452 FFVP*SQSFWASVQSSIWKLLAWVWQFWLL 541 FFVP F +Q + AW+W WLL Sbjct: 433 FFVPPPLMF---LQDFLSHQHAWIWLVWLL 459 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 278 WMPTTSLNSLSRLKQQ*RRLKITTPWSLL 192 WMP+T N L L +KI S+L Sbjct: 853 WMPSTMANILDLLMDYEHTVKINENISML 881 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/28 (32%), Positives = 11/28 (39%) Frame = -1 Query: 552 GCGNSSQNCQTQASSFQIEDCTEAQKDW 469 G G + C T A F DC+ W Sbjct: 498 GNGRCDEECNTYACEFDGNDCSLGINPW 525 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 23.0 bits (47), Expect = 2.7 Identities = 15/69 (21%), Positives = 27/69 (39%) Frame = +2 Query: 344 GLRKCTELRIFRTLFPCSPFTTFL*ALSALVTGFTTFFVP*SQSFWASVQSSIWKLLAWV 523 G C ++ +TL P+ + ++ + P + W S +S + LAWV Sbjct: 109 GFLLCKVVKYGQTL---GPYLSSYVLMATAIDRHQAICYPLTYCSWTSRRSKVMVYLAWV 165 Query: 524 WQFWLLLPQ 550 +PQ Sbjct: 166 ASLAFCIPQ 174 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.6 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 515 AWVWQFWLL 541 AW+W WLL Sbjct: 464 AWIWLLWLL 472 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.6 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 515 AWVWQFWLL 541 AW+W WLL Sbjct: 464 AWIWLLWLL 472 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.6 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 515 AWVWQFWLL 541 AW+W WLL Sbjct: 464 AWIWLLWLL 472 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.6 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 515 AWVWQFWLL 541 AW+W WLL Sbjct: 464 AWIWLLWLL 472 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 142 SFLTAALXMVLVCTCVDNKDQGVVIFNLLHCCFRREREFNDVVGI 276 SF+T + +VC V D+ V I+ L++ C + ND I Sbjct: 282 SFVTVPM---IVCPIVWLMDEVVEIYLLVYACASTCEQANDTPSI 323 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 142 SFLTAALXMVLVCTCVDNKDQGVVIFNLLHCCFRREREFNDVVGI 276 SF+T + +VC V D+ V I+ L++ C + ND I Sbjct: 282 SFVTVPM---IVCPIVWLMDEVVEIYLLVYACASTCEQANDTPSI 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,367 Number of Sequences: 336 Number of extensions: 2419 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -